Recombinant Human Appetite-Regulating Hormone (GHRL) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08707P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Appetite-Regulating Hormone (GHRL) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08707P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Appetite-Regulating Hormone (GHRL) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9UBU3 |
| Target Symbol | GHRL |
| Synonyms | Appetite regulating hormone; Ghrelin 27; Ghrelin 28; Ghrelin and obestatin prepropeptide; Ghrelin; Ghrelin/obestatin prepropeptide ; ghrl; GHRL_HUMAN; Growth hormone releasing peptide; Growth hormone secretagogue; Growth hormone-releasing peptide; M46 protein; Motilin related peptide; Motilin-related peptide; MTLRP ; Obestatin; Protein M46 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK |
| Expression Range | 1-117aa |
| Protein Length | Full Length of BC025791 |
| Mol. Weight | 39.9kDa |
| Research Area | Cardiovascular |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation.; Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility. |
| Subcellular Location | Secreted. |
| Protein Families | Motilin family |
| Database References | HGNC: 18129 OMIM: 605353 KEGG: hsa:51738 STRING: 9606.ENSP00000335074 UniGene: PMID: 29412824 |
