Recombinant Human Apolipoprotein CII/ApoC-II / APOC2 Protein
Beta LifeScience
SKU/CAT #: BLA-0106P
Recombinant Human Apolipoprotein CII/ApoC-II / APOC2 Protein
Beta LifeScience
SKU/CAT #: BLA-0106P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Host Species | Human |
| Accession | P02655 |
| Synonym | APC 2 APC2 Apo CII Apo-CII APOC 2 ApoC II ApoC-II APOC2 APOC2 protein APOC2_HUMAN ApoCII Apolipoprotein C II Apolipoprotein C II precursor Apolipoprotein C2 ApolipoproteinCII MGC75082 ProapoC-II Proapolipoprotein C-II |
| Description | Recombinant Human Apolipoprotein CII/ApoC-II / APOC2 Proteinwas expressed in E.coli. It is a Full length protein |
| Source | E.coli |
| AA Sequence | MTQQPQQDEMPSPTLLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKL RDLYSKSTAAMSTYTGIFTDQVLSVLKGEELEHHHHHH |
| Molecular Weight | 10 kDa including tags |
| Purity | >95% SDS-PAGE |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Liquid Solution |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped on Dry Ice. Store at -20°C. Avoid freeze / thaw cycle. |
Target Details
| Target Function | Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase. Both proapolipoprotein C-II and apolipoprotein C-II can activate lipoprotein lipase. In normolipidemic individuals, it is mainly distributed in the HDL, whereas in hypertriglyceridemic individuals, predominantly found in the VLDL and LDL. |
| Subcellular Location | Secreted. |
| Protein Families | Apolipoprotein C2 family |
| Database References | HGNC: 609 OMIM: 207750 KEGG: hsa:344 STRING: 9606.ENSP00000466775 UniGene: PMID: 29371683 |
