Recombinant Human Apolipoprotein C-I (APOC1) Protein (His-SUMO)

Name: Recombinant Human Apolipoprotein C-I (APOC1) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-05186P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality cytokines for advanced research, High-quality recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Apolipoprotein C-I (APOC1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P02654
Target Symbol	APOC1
Synonyms	APO C1; Apo CI; Apo-CIB; Apo-CIB'; APOC 1; ApoC I; ApoC-IB; ApoC-IB'; APOC1; APOC1_HUMAN; APOC1B; Apolipoprotein C I; Apolipoprotein C I variant I; Apolipoprotein C-I; Apolipoprotein C1; Apolipoprotein CI; ApolipoproteinC I; ApolipoproteinCI; Truncated apolipoprotein C-I
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS
Expression Range	27-83aa
Protein Length	Full Length of Mature Protein
Mol. Weight	22.6 kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.
Subcellular Location	Secreted.
Protein Families	Apolipoprotein C1 family
Database References	HGNC: 607 OMIM: 107710 KEGG: hsa:341 STRING: 9606.ENSP00000252491 UniGene: PMID: 28065845 Collectively, these findings suggest that apoC1 and apoE have redundant functions in the hepatitis C virus (HCV) infection and morphogenesis. PMID: 30130702 the relationship between two variants of apoC1 and the risk of polycystic ovary syndrome, evaluated the genotypic effects on clinical, hormonal and metabolic indexes and plasma platelet-activating factor acetylhydrolase (PAF-AH) activity, was investigated. PMID: 29636060 Performance metrics were used to select SNPs in stage 1, which were then genotyped to another dataset (stage 2). Four SNPs (CPXM2 rs2362967, APOC1 rs4420638, ZNF521 rs7230380, and rs12965520) were identified for LOAD by both traditional P-values (without correcting for multiple tests) and performance metrics. PMID: 27805002 ApoC-I polymorphism might be one of the genetic factors of longevity in Bama; the ApoC-I rs4420638 and rs584007 SNPs are associated with serum triglycerides and high-density lipoprotein-cholesterol levels in the longevous population PMID: 28486432 Among white women, three single nucleotide polymorphisms (SNPs) (rs2075650 [TOMM40], rs4420638 [APOC1], and rs429358 [APOE]) were significantly associated with survival to 90 years after correction for multiple testing (p < .001); rs4420638 and rs429358 were also significantly associated with healthy aging (p = .02). In African American women, no SNP was associated with longevity. In Hispanic women, 7 SNPs in linkage dise PMID: 27707806 APOC1 expression induces glomerulosclerosis, potentially by increasing the cytokine response in macrophages. PMID: 27976371 apoC-I inhibited in situ LPL activity in adipocytes in both a concentration- and time-dependent manner. There was no change in postprandial WAT apoC-I secretion. WAT apoC-I secretion may inhibit WAT LPL activity and promote delayed chylomicron clearance in overweight and obese subjects PMID: 27040450 People with allelic variation in four genes related to cardiovascular diseases and metabolism were more likely to die: apolipoprotein (APO)C1 GG and AG carriers, APOE varepsilon4 carriers, insulin-degrading enzyme (IDE) TC carriers, and phosphatidylinositol 3-kinase (PI3KCB) GG carriers. PMID: 27806189 Common single-nucleotide polymorphism in the APOC1/APOE region, previously found to be associated with protective levels of cholesterol and lower cardiovascular risk, may be associated with ideal health. PMID: 27179730 These findings indicated that variants in TOMM40/APOE/APOC1 region might be associated with human longevity. Further studies are needed to identify the causal genetic variants influencing human longevity. PMID: 26657933 These results suggest that ApoC-I peptides may be a potential diagnostic biomarker and therapeutic approach for breast cancer. PMID: 27052600 APOC1 SNP is associated with the A beta-42 levels in CSF. PMID: 26576771 This sbioinformatics analysis explored the shared genetic etiology underlying Type 2 Diabetes and Alzheimer's Disease on SNP level, gene level, and pathway level. Six SNPs on APOC1 gene. PMID: 26639962 The endogenous retroviral promoters (LTRs) of the human endothelin B receptor (EDNRB) and apolipoprotein C1 (APOC1) genes have high sequence identity but differ in activity and tissue specificity. PMID: 12805445 The ability of apoC1 to inhibit CETP activity is impaired in patients with diabetes. Glycation of apoC1 leads to a change in its electrostatic properties that might account, at least in part, for a loss of constitutive CETP inhibition and an increase in plasma CETP activity in patients with diabetes. PMID: 24574346 APOE e4 allele status is associated with dementia and severity of Alzheimer's disease pathologic features in Parkinson disease. PMID: 24582705 Data indicate that apolipoprotein C-I (APOC1) rs11568822 polymorphism was associated with increased Alzheimer's disease (AD) risk in Caucasians, Asians and Caribbean Hispanics, but not in African Americans. PMID: 24498013 results suggest that peptide-lipid interactions drive alpha-helix binding to and retention on lipoproteins PMID: 23670531 apoC-I and apoC-III inhibit lipolysis by displacing LPL from lipid emulsion particles. We also propose a role for these apolipoproteins in the irreversible inactivation of LPL by factors such as angptl4. PMID: 24121499 Following regression analysis adjusted by collection center, gender, duration of diabetes, and average HbA1c, two SNPs were significantly associated with DN. rs4420638 in the APOC1 region and rs1532624 in CETP. PMID: 23555584 Linkage disequilibrium between APOC1 and TOMM40 is found in patients with primary progressive aphasia but not in controls or patients with frontotemporal dementia. PMID: 22710912 High concentrations of ApoCI are associated with increased triglycerides and decreased visceral fat mass in men with metabolic syndrome X. PMID: 18835943 Increased white adipose tissue apoC-I secretion in obese women is associated with delayed postprandial dietary fat clearance mediated by increased triglyceride rich apoC-I. PMID: 22995522 The plasma level of apoC-I was significantly increased in obese individuals compared with healthy individuals. PMID: 22404376 apoC1 as a CETP inhibitor no longer operates on cholesterol redistribution in high-risk patients with dyslipidemia PMID: 22474067 The observed increase in apoC-I interface affinity due to higher degrees of apoC-I-palmitoyloleoylphosphatidylcholine/triolein/water interactions may explain how apoC-I can displace larger apolipoproteins, such as apoE, from lipoproteins. PMID: 22264166 our approach, which is applicable to any set of interval scale traits that is heritable and exhibits evidence of phenotypic clustering, identified three new loci in or near APOC1, BRAP, and PLCG1, which were associated with multiple phenotype domains. PMID: 22022282 Results describe the association of ACE and APOC1 gene polymorphisms with susceptibility to Alzheimer's disease and dementia in general, both alone and combined with the APOE gene. PMID: 21533863 variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits PMID: 21943158 Serum levels of apoC-I and apoC-III combined with other clinical parameters can serve as a basis for the formulation of a diagnostic score for stomach cancer patients PMID: 21267442 New isoforms of apoC-I, were detected in the cohort of individuals with coronary artery disease using mass spectrometry while the expected apoC-I isoforms were absent. PMID: 21187063 This study examines the association between APOE/C1/C4/C2 gene cluster variation using tagging single nucleotide polymorphisms and plasma lipid concentration along with risk of coronary heart disease in a prospective cohort. PMID: 20498921 data show that apoCI genotype is associated with serum levels of triglycerides and CRP, confirming the role of apoCI in lipid metabolism and suggesting that it also influences inflammation PMID: 20580041 From genetic association studies in Canadian Oji-Cree subjects, APOC1 T45S polymorphism may be linked to obesity, adipocyte regulation, body fat, waist circumference, hyperglycemia, and plasma leptin and apolipoprotein C-I levels. PMID: 19812053 Apolipoprotein C-I reduces cholesteryl esters selective uptake from LDL and HDL by binding to HepG2 cells and lipoproteins PMID: 19761869 ApoC-I may have an important role in glucose and lipid metabolism and may be useful for early demonstration of metabolic abnormality in women with polycystic ovary syndrome. PMID: 19368908 ApoE e4 and APOC1 A alleles have a better association with Alzheimer disease than ApoE e4 alone. PMID: 20145290 Results identified haptoglobin alpha-1, apolipoprotein C-I and apolipoprotein C-III as candidate biomarkers in PTC. PMID: 19785722 Cholesteryl ester transfer protein is the sole major determinant of cholesteryl ester transfer in normolipidemic rabbit plasma as a result of the inability of rabbit apoCI to change HDL electronegativity. PMID: 19417222 APOC1 might be an additional susceptibility gene for late onset Alzheimer disease. PMID: 11825674 regulated expression of gene cluster in macrophages PMID: 12032151 Thermal unfolding of discoidal complexes of apolipoprotein (apo) C-1 with dimyristoyl phosphatidylcholine (DMPC) reveals a novel mechanism of lipoprotein stabilization that is based on kinetics rather than thermodynamics. PMID: 12044170 Effects of mutations in apolipoprotein C-1 on the reconstitution and kinetic stability of discoidal lipoproteins. PMID: 12705839 The effect of APOC1 genes on brain MRI measures were studied in subjects with age-associated memory impairment. The effects of APOC1 on hippocampal volumes appeared to be more robust than those of the APOE polymorphism. PMID: 12736801 overexpression of APOC1 prevents rosiglitazone-induced peripheral fatty acid uptake leading to severe hepatic steatosis PMID: 14523051 overexpression of apoCI does not represent a suitable method for decreasing total CE transfer activity in CETP/apoCI transgenic mice, owing to an hyperlipidaemia-mediated effect on CETP gene expression PMID: 15339254 apoC-I is a potent inhibitor of LPL-mediated triglyceride lipolysis PMID: 15576844 role of apolipoprotein C1 in the infection process of hepatitis C virus PMID: 15767578 Results suggested that both apoE and apoCI on chromosome 19 were the susceptibility loci for coronary artery disease, their linkage disequilibrium should be responsible for the development of coronary artery disease . PMID: 15793777

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.