Recombinant Human Apolipoprotein C-I (APOC1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11231P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Apolipoprotein C-I (APOC1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11231P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Apolipoprotein C-I (APOC1) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P02654 |
Target Symbol | APOC1 |
Synonyms | APO C1; Apo CI; Apo-CIB; Apo-CIB'; APOC 1; ApoC I; ApoC-IB; ApoC-IB'; APOC1; APOC1_HUMAN; APOC1B; Apolipoprotein C I; Apolipoprotein C I variant I; Apolipoprotein C-I; Apolipoprotein C1; Apolipoprotein CI; ApolipoproteinC I; ApolipoproteinCI; Truncated apolipoprotein C-I |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-10His |
Target Protein Sequence | TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS |
Expression Range | 27-83aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 12.7 kDa |
Research Area | Cardiovascular |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein. |
Subcellular Location | Secreted. |
Protein Families | Apolipoprotein C1 family |
Database References | HGNC: 607 OMIM: 107710 KEGG: hsa:341 STRING: 9606.ENSP00000252491 UniGene: PMID: 28065845 |