Recombinant Human Ap-1 Complex Subunit Sigma-3 (AP1S3) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-10277P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Ap-1 Complex Subunit Sigma-3 (AP1S3) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-10277P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Ap-1 Complex Subunit Sigma-3 (AP1S3) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q96PC3 |
Target Symbol | AP1S3 |
Synonyms | Adapter-related protein complex 1 subunit sigma-1C; Adaptor protein complex AP 1 sigma 1C subunit; Adaptor protein complex AP-1 subunit sigma-1C; Adaptor related protein complex 1 sigma 3 subunit; AP-1 complex subunit sigma-3; Ap1s3; AP1S3_HUMAN; Clathrin assembly protein complex 1 sigma-1C small chain; Golgi adaptor HA1/AP1 adaptin sigma-1C subunit; Sigma 1C subunit of AP-1 clathrin; Sigma-adaptin 1C; Sigma1C-adaptin |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNTWPFARA |
Expression Range | 1-104aa |
Protein Length | Full Length of Isoform 3 |
Mol. Weight | 39.7kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. Involved in TLR3 trafficking. |
Subcellular Location | Golgi apparatus. Cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Membrane, clathrin-coated pit. Note=Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex. |
Protein Families | Adaptor complexes small subunit family |
Database References | HGNC: 18971 OMIM: 615781 KEGG: hsa:130340 STRING: 9606.ENSP00000379891 UniGene: PMID: 27079945 |