Recombinant Human Anoctamin-1 (ANO1) Protein (His&Myc)

Name: Recombinant Human Anoctamin-1 (ANO1) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-00386P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Anoctamin-1 (ANO1) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q5XXA6
Target Symbol	ANO1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	SFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLA
Expression Range	806-892aa
Protein Length	Partial
Mol. Weight	17.6 kDa
Research Area	Tags & Cell Markers
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Calcium-activated chloride channel (CaCC) which plays a role in transepithelial anion transport and smooth muscle contraction. Required for the normal functioning of the interstitial cells of Cajal (ICCs) which generate electrical pacemaker activity in gastrointestinal smooth muscles. Acts as a major contributor to basal and stimulated chloride conductance in airway epithelial cells and plays an important role in tracheal cartilage development.
Subcellular Location	Cell membrane; Multi-pass membrane protein. Cytoplasm.
Protein Families	Anoctamin family
Database References	HGNC: 21625 OMIM: 610108 KEGG: hsa:55107 STRING: 9606.ENSP00000347454 UniGene: PMID: 29360145 This will include discussion of developed knockout models that have provided much needed insight on the functional localization of TMEM16A in several epithelial tissues. Finally, this review will examine the implications of the identification of TMEM16A as it pertains to potential novel therapies in several pathologies PMID: 29748496 Inhibition of STAT6/Anoctamin-1 activation decreased proliferation, migration, or invasion of gastric cancer cells. PMID: 29466035 The effect of CLCA2 on ICaCC (calcium-activated chloride channel currents) was tested in HEK293 cells stably expressing calcium-activated chloride channel TMEM16A. PMID: 29758025 TMEM16A expression was found to correlate with greater tumor size, less Bim expression, and less apoptotic activity overall in head and neck squamous cell carcinomas (HNSCCs). PMID: 28899969 resveratrol (RES) might be a promising drug for the treatment of gastrointestinal hypomotility. As RES was able to induce TMEM16A channel activation, TMEM16A can be added to the list of RES drug targets. PMID: 28852814 results indicate that the enhanced activity in chimeric channels is due to altered interaction between the carboxy-terminus and the first intracellular loop in the TMEM16A homo-dimer. Mimicking this perturbation with a small molecule could be the basis for a pharmacological stimulation of TMEM16A-dependent Cl(-) transport. PMID: 27929144 ANO1 overexpression associated with the high expression of EGFR can be a predictive marker of recurrence after surgery in non-small cell lung cancer PMID: 28299581 Study demonstrated that segment a is a critical domain for the surface expression of ANO1, and identified 14-3-3gamma as a binding partner for this segment enhancing the surface expression of ANO1. In addition, gene silencing of 14-3-3gamma and/or ANO1 inhibited migration and invasion of these glioblastoma cell lines. PMID: 27212225 lipids and fatty acids regulate TMEM16A channels through a membrane-delimited protein-lipid interaction. PMID: 29277655 knockdown of ESYT1 (and family members ESYT2 and ESYT3) significantly decreased ANO1 current density. PMID: 29154949 labeled proteins were imaged and showed that hTMEM16A resides in the plasma membrane as dimer only and is not present as monomer. PMID: 28559167 ANO1 overexpression promotes cancer cell proliferation and migration. Genetic or pharmacological inhibition of ANO1 induces apoptosis and cell cycle arrest at G1 phase in different types of epithelium-originated cancer cells. PMID: 27732935 Furthermore, the overexpression of ANO1 has a significant effect on both distant metastasis and poor prognosis. Our results suggest a potential role for ANO1 in CRC through miR-132. PMID: 26868958 Data show that ANO1 in peripheral blood is of clinical potential for monitoring recurrence and evaluating therapeutic efficacy of imatinib for GIST patients. PMID: 27153560 Results show that TMEM16A is a direct target of miR-381 and its expression in gastric neoplasm is inversely correlated to that of miR-381.TMEM16A mediates the functional effects of miR-381 on migration and invasion in gastric cancer cells. PMID: 28193228 Positive anoctamin 1 (ANO1) is a promising biomarker to predict the unfavorable outcome for ESCC patients and disease progression of precancerous lesions. PMID: 27016410 TMEM16A expression was enhanced by 24-h treatment of IL-4 in human nasal epithelial cells. PMID: 28546154 findings demonstrate that Ca2+ influx via store-operated CRAC channels is essential for CaCC activation, chloride secretion, and sweat production in humans and mice. PMID: 27721237 TMEM16A activation as a sequential, direct, and Vm-dependent binding. PMID: 27138167 Ano1(0) without EAVK [Ano1(0)DeltaEAVK] has reduced sensitivity for intracellular calcium, attributable to slower kinetics. Differential expression of EAVK may function as a calcium-sensitive switch in the human stomach. PMID: 28336549 Gains of ANO1 is associated with oropharyngeal squamous cell carcinoma. PMID: 27750372 DOG1 is a novel marker for identifying intercellular canaliculi and is a potential immunomarker of myoepithelial cells specific to mammary glands, anogenital mammary-like glands and tumors originating therein. PMID: 27506854 Increase in TMEM16A activity occurred within minutes of exposure to CLCA1 or after a short treatment with nocodazole, consistent with the hypothesis that CLCA1 stabilizes TMEM16A at the cell surface by preventing its internalization. PMID: 28420732 These results suggest that ANO1 Cl(-) channels may function as a transcriptional regulator of HER2, and ANO1 inhibitors have potential in the treatment of BCA patients with resistance to HER2-targeted therapy. PMID: 27838298 Endogenous ANO1 was associated with COPB1 in U251 glioblastoma cells, and silencing of COPB1 enhanced surface expression and whole-cell currents of ANO1 in these cells. Taken together, these data suggest that COPB1 negatively regulates ANO1 surface expression. PMID: 27207835 targeting TMEM16A improves response to biological therapies targeting EGFR/HER family members PMID: 28177558 STAT6-TMEM16A-ERK1/2 signal pathway and TMEM16A channel activity are required for the IL-13-induced TMEM16A mediated mucus production PMID: 27588910 DOG1 positivity was detected in most gastrointestinal stromal tumors and its overexpression was related with adverse prognosis PMID: 28044310 DOG1 positivity might be a candidate marker to support KIT and PDGFRA mutations. PMID: 27178821 Results showed that DOG1 expression was consistently positive in breast myoepithelial cells (MEC), and is then a useful MEC marker providing more sophisticated information when diagnosing uncertain cases in the breast. PMID: 27041791 ANO1 on ICCs makes a key contribution to generation and regulation of pacemaker electrical slow-wave activity. PMID: 26510736 Data show that calcium-activated chloride channel TMEM16 overexpression correlates with decreased survival in human papilloma virus -negative tumors. PMID: 26563938 DOG1 was expressed in 66% of CD117(+) GISTs and highly associated with tumor size and the rate of wild-type tumors PMID: 26867653 DOG1 positivity in select non-GIST tumors. PMID: 26678977 Our results indicated that both the electrical property and the size of the side-chain at residue 447 have significant effects on Ca(2+) dependent gating of TMEM16A. PMID: 26481648 ANO1 expression and gene amplification showed no significant associations with clinicopathological parameters in HNSCC. PMID: 26498851 DOG1 is a sensitive marker in the diagnosis of acinic cell carcinoma PMID: 26464669 TCGA analysis showed that ANO1 and FADD, located at 11q13, were co-expressed at transcript level and significantly associated with overall and disease-free survival PMID: 26808319 Aberrant c-KIT and DOG-1 expressions in CRC are rare events, either in NMA or MA. PMID: 26272691 Anoctamin and pendrin are two plausible candidates as mediators of apical iodide efflux--{review} PMID: 26313899 our findings provide evidence that ANO1 overexpression contributes to tumor growth and invasion of lung cancer; and suppressing ANO1 overexpression may have therapeutic potential in lung cancer therapy PMID: 26305547 DOG1 expression was found in low-grade fibromyxoid sarcoma, highlighting the potential for diagnostic confusion with gastrointestinal stromal tumors. PMID: 26135531 DOG-1, VEGFA and p16 are expressed in cutaneous basal and squamous cell carcinomas PMID: 26429157 PKCalpha is coupled to ATP-stimulated TMEM16A activation in biliary epithelial cells. PMID: 26542395 gastrointestinal stromal tumors with mutations in the DOG1 gene were not found PMID: 26191287 Pancreatic ductal adenocarcinoma cell lines showed an upregulation of ANO1 on mRNA and protein levels. ANO1 is the main constituent of CaCC current in PDAC cells. PMID: 25163766 TMEM16A overexpression promotes invasion and metastasis in gastric cancer. PMID: 25839162 ANO1 and EGFR form a functional complex that jointly regulates head & neck squamous cell carcinoma cell proliferation. PMID: 25823819 examined TMEM16A protein interactions with calmodulin and CaMKIIdelta likely cause efflux of chloride, thus resulting in increased vascular resistance by increasing vascular wall tone in long-standing hypertension PMID: 25914185

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.