Recombinant Human Annexin A6 (ANXA6) Protein (GST)

Name: Recombinant Human Annexin A6 (ANXA6) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-08529P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Annexin A6 (ANXA6) Protein (GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P08133
Target Symbol	ANXA6
Synonyms	67 kDa calelectrin; Annexin A6; Annexin VI; Annexin VI p68; Annexin-6; AnnexinA6; AnnexinVI; ANX 6; ANX A6; ANX6; ANXA 6; ANXA6; ANXA6_HUMAN; Calcium binding protein p68; Calelectrin; Calphobindin II; Calphobindin-II; CalphobindinII; CBP 68; CBP68; Chromobindin 20; Chromobindin-20; Chromobindin20; CPB II; CPB-II; CPBII; Lipocortin VI; LipocortinVI; p68; p70; Protein III; ProteinIII
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	AKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYERDLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAV
Expression Range	2-245aa
Protein Length	Partial
Mol. Weight	54.4kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May associate with CD21. May regulate the release of Ca(2+) from intracellular stores.
Subcellular Location	Cytoplasm. Melanosome. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Protein Families	Annexin family
Database References	HGNC: 544 OMIM: 114070 KEGG: hsa:309 STRING: 9606.ENSP00000346550 UniGene: PMID: 28060548 Immunoprecipitation of the products obtained from the transcription/translation system using various anti-annexin A6 antibodies confirmed the presence of several isoforms and suggested that this protein might be present in different configurations. PMID: 27743858 AnxA6 protein in adipocytes was upregulated by oxidative stress which might trigger AnxA6 induction in adipose tissues and contribute to impaired fat storage and adiponectin release. PMID: 27702590 High ANXA6 expression is associated with neoplasms. PMID: 28881357 stable or transient AnxA6 overexpression in HuH7 cells led to elevated lipid droplet numbers/size and neutral lipid staining under control conditions PMID: 28712927 Annexin VI is enriched in calcifying valve interstitial cell derived-matrix vesicles from patients with end stage renal disease-induced hypercalcemia and aortic valve calcification. PMID: 28369848 These findings suggest that cancer-associated fibroblasts -tumor cell crosstalk supported by ANXA6+ EVs is predictive of pancreatic ductal adenocarcinoma aggressiveness, highlighting a therapeutic target and potential biomarker for pancreatic ductal adenocarcinoma. PMID: 27701147 The current study shows that AnxA6 is specifically reduced in human hepatocellular carcinoma suggesting a role of this protein in hepatocarcinogenesis. PMID: 27334756 Data suggest that reduced ability of AnxA6-expressing cells to migrate is associated with decreased cell surface expression of integrins alphaVbeta3 and alpha5beta1. PMID: 26578516 ANXA6 was detected as a novel systemic lupus erythematosus susceptibility gene, with several single-nucleotide polymorphisms (SNPs) contributing independently to the association with disease PMID: 26202167 ANXA6 is a EZH2 target gene involving gastric cellular proliferation. PMID: 25947258 Evidence for annexin A6-dependent plasma membrane remodelling of lipid domains PMID: 25409976 The rapid degradation of activated EGFR in AnxA6-depleted invasive tumor cells underlies their sensitivity to EGFR-targeted inhibitors. PMID: 24354805 These results show that influenza A virus replication depends on maintenance of the cellular cholesterol balance and identify AnxA6 as a critical factor in linking the virus to cellular cholesterol homeostasis. PMID: 24194536 TNIP1/ANXA6 and CSMD1 variants interacting with cigarette smoking and alcohol intake affect risk of psoriasis. PMID: 23541940 Influence of the 524-VAAEIL-529 sequence of annexins A6 in their interfacial behavior and interaction with lipid monolayers. PMID: 23683957 Ca(2+) is the main factor which regulates the interaction of AnxA6 with monolayers composed of neutral lipids, determine AnxA6 localization in cholesterol and sphingomyelin enriched microdomains, thus contributing to the etiology of the NPC disease. PMID: 23360953 AnxA6 is a new PKCalpha scaffold to promote PKCalpha-mediated EGFR inactivation. PMID: 22797061 anxA6 inhibits Drp1 activity, and Ca(2+)-binding to anxA6 relieves this inhibition to permit Drp1-mediated mitochondrial fission PMID: 23341998 AnxA6 via its stimulatory actions on PKCalpha and its role in mediating Ca(2+) flux across membranes regulates terminal differentiation and mineralization events of chondrocytes. PMID: 22399299 the regulation of cell surface receptors by annexin A6 may be facilitated by its unique structure that allows recruitment of interaction partners and simultaneously bridging specialized membrane domains with cortical actin surrounding activated receptors PMID: 21990038 AnxA6 is a novel receptor that mediates the endocytosis of bovine beta-glucuronidase. PMID: 21672540 In addition to regulating cholesterol and caveolin distribution, AnxA6 acts as a scaffold/targeting protein for several signaling proteins. PMID: 20888375 reduced AnxA6 expression contributes to breast cancer progression by promoting the loss of functional cell-cell and/or cell-ECM contacts and anchorage-independent cell proliferation PMID: 21185831 In the presence of calcium, AnxA6 re-located to the fractions enriched in detergent-resistant microdomains only in the Niemann-Pick type C disease cells, suggestive of AnxA6 participation in organization of these microdomains. PMID: 21216236 High ANXA6 expression in the cytoplasm is associated with uterine cervix carcinogenesis. PMID: 21119665 Data suggests that the hydroxyl group of cholesterol and Trp 343 are involved in AnxA6-membrane interactions. PMID: 20363475 AnxA6 may participate in formation of cholesterol-rich platforms on LE and therefore may contribute to the pathology of the NPC disease. PMID: 19900398 Data show that annexin 6 is a candidate receptor for chondroitin sulfate chains. PMID: 12140262 Characterization of phosphorylation-mimicking mutant annexin VI (T356D) reveals a potential regulatory mechanism leading to a higher degree of flexibility and possibly a higher calcium binding affinity of annexin VI upon phosphorylation. PMID: 12534274 The nucleotide-binding site of ANXA6 is formed by the amino acid residues located in both halves of the protein, in two distinct domains. PMID: 12885247 cell surface annexin VI may function as an acidic pH binding site or receptor and may also function as a co-receptor with LRP-1 at neutral pH PMID: 15226301 endogenous annexin 6 could regulate the Maxi-chloride channel in placenta PMID: 15355961 TPD52 bound to annexin VI in a Ca(2+)-dependent manner suggesting that these molecules may act in concert to regulate secretory processes in plasma cells PMID: 15576473 Macrophage reprogramming during oxidative stress occurs through the cytosolic mobilization of annexin VI from lipid rafts. PMID: 16153422 It is a first report supporting the hypothesis of a direct implication of AnxA6 in vitamin A-dependent tissue mineralization. PMID: 16674946 Annexin A6 has roles in alterations in cholesterol transport and caveolin export from the Golgi complex PMID: 17822395 AnxA6 interferes with caveolin transport through the inhibition of cPLA(2). PMID: 18245088 annexin A6 contributes to the calcium-dependent cell surface exposition of the membrane associated-S100A8/A9 complex PMID: 18786929 Annexin A6 is highly abundant in monocytes of obese and type 2 diabetic individuals. PMID: 19322030 results implicate annexin A6 in the actin-dependent regulation of Ca(2+) entry, with consequences for the rates of cell proliferation PMID: 19386597

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.