Recombinant Human Annexin A5 (ANXA5) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-04789P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Annexin A5 (ANXA5) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-04789P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Annexin A5 (ANXA5) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P08758
Target Symbol ANXA5
Synonyms Anchorin CII; Annexin 5; Annexin A5; Annexin V; Annexin-5; Annexin5; AnnexinA5; AnnexinV; ANX 5; ANX A5; ANX5; ANXA5; ANXA5_HUMAN; Calphobindin I; CBP-I; Endonexin II; ENX 2; ENX2; Lipocortin V; PAP I; PAP-I; Placental anticoagulant protein 4; Placental anticoagulant protein I; PLACENTAL PROTEIN 4; PP 4; Pp4; RPRGL3; Thromboplastin inhibitor; VAC-alpha; Vascular anticoagulant-alpha
Species Homo sapiens (Human)
Expression System E.coli
Tag N-GST
Target Protein Sequence AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Expression Range 2-320aa
Protein Length Full Length of Mature Protein
Mol. Weight 62.8 kDa
Research Area Cancer
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.
Protein Families Annexin family
Database References

HGNC: 543

OMIM: 131230

KEGG: hsa:308

STRING: 9606.ENSP00000296511

UniGene: PMID: 28176826

  • Caspase-3 and -8 and annexin V may serve as diagnostic markers in Ovarian cancer , also explained that the decrement in control of the S phase in the cell cycle may considered one of the significant factors in the development of ovarian tumors PMID: 30197345
  • When ANXA5 expression increased, cell proliferation was inhibited by regulating the expression of bcl-2 and bax while cell metastasis was suppressed by regulating E-cadherin and MMP-9 expression. PMID: 30010106
  • Maternal carriers of the ANXA5 M2 haplotype has greater risk of developing placenta-mediated pregnancy complications, such as preeclampsia and intrauterine growth restriction. PMID: 29497952
  • The domain IV-truncated form of anxA5 is impaired in binding phosphatidylserine liposome and apoptotic cells, and anticoagulation activity. PMID: 29257055
  • increase in VEGF and Apelin, and decrease in Annexin A5 supports roles of hemo-dynamic alterations in fetoplacental circulation and structural alterations in uteroplacental bed occurring in preeclampsia. PMID: 29208172
  • In patients with colon cancer, annexin A5 expression in cancer tissues is related to lymph node metastasis and tumor grade. Serum level of annexin A5 is related to annexin A5 expression in cancer tissues. PMID: 29093625
  • annexin A5 anticoagulant has a role in adverse outcomes in antiphospholipid antibody positive patients with thrombosis or pregnancy complications PMID: 28393472
  • There was no significant difference in circulating ANXA5 levels between subjects of the non-pregnant, RPL and parous groups (median, 0.25 ng/ml vs. 0.21 ng/ml vs. 0.01 ng/ml, p = 0.14) (Fig. 1A ). Similarly, no significant differences in circulating ANXA5 levels were observed across these three clinical subgroups among M2-carriers or non-carriers, respectively. PMID: 28605660
  • Serum annexin A5 level was not altered in pre-eclampsia. PMID: 28501283
  • Annexin A5 was proposed to use in detection of apoptosis. associated with the Breast Cancer. Upregulation of the AA5 protein is detected in Pleomorphic Adenoma of the Parotid Gland. PMID: 28497265
  • Physiological function of ANXA5 as an embryonic anticoagulant that appears deficient in contiguous specter of thrombophilia-related pregnancy complications culminating more frequently in miscarriage in a maternal M2 carrier background. PMID: 28900802
  • This study confirmed the proposed role of M2/ANXA5 as embryonic, genetically associated thrombophilia predisposition factor for early recurrent pregnancy loss among ethnic Malay of Malaysia. PMID: 28108842
  • Circulating anxA5 levels are associated with carotid intima-media thickness but not coronary plaque composition in high-risk patients with diabetes mellitus. PMID: 28592134
  • Results showed that ANXA5 rs1050606 was significantly associated with left ventricular hypertrophy in Chinese endogenous hypertension patients. PMID: 29095261
  • Moreover, mechanism study exhibited that Annexin A5 could activate PI3K/Akt/mTOR signaling pathway, promote epithelial-mesenchymal transition (EMT) and the expression of MMP2 and MMP9. Annexin A5 may be a potential prognostic biomarker in RCC and promotes proliferation, migration and invasion of RCC cells via activating PI3K/Akt/mTOR signaling pathway and regulating EMT process and MMP expression. PMID: 28393205
  • human myotubes rendered deficient for Annexin-A5 (AnxA5) suffer from a severe defect in membrane resealing. PMID: 27286750
  • This study functionally characterized allelic variants in the ANXA5 promoter, both alone and in combinations, and the results suggest that combinations of several individual variants contribute to modulate the ANXA5 transcriptional activity, most likely through binding of nuclear factors. PMID: 27318245
  • Chronically increased alveolar annexin V levels, as reflected in increased idiopathic pulmonary fibrosis (IPF) BALF levels, may contribute to the progression of IPF by inducing the release of pro-fibrotic mediators. PMID: 26160872
  • lower exhaled breath condensate annexin A5 levels in children with exercise-induced asthma compared to non-exercised-induced one PMID: 25796304
  • The M2 haplotype is a risk factor for early spontaneous abortions, before the 12th week of gestation, and confers about the same relative risk to carriers of both sexes. PMID: 26371709
  • annexin A5 promoter haplotype M2 may not have a role in recurrent pregnancy loss in Estonia or Denmark PMID: 26135579
  • Annexin V is fused to an enzyme, creating a fusion protein that converts nontoxic drug precursors, prodrugs, into anticancer compounds while bound to the tumor, therefore mitigating the risk of side effects. PMID: 25899647
  • Neither the M1/M2 haplotypes nor the tag SNPs in ANXA5 were convincingly associated with pregnancy related venous thromboembolism. PMID: 25495894
  • Anx5 could protect cardiomyocytes adherens junctions and improve myocardial contractile function via regulation of p120 and anti-inflammation in LPS-induced endotoxemia. PMID: 25799159
  • The associated male partner risk confirms the proposed role of M2/ANXA5 as a genetic trait impeding embryonic anticoagulation. PMID: 25682309
  • AnxA5 promotes membrane resealing of injured human trophoblasts. PMID: 25595530
  • ANXA5 haplotypes/plasma ANXA5 levels were not associated with carotid IMT progression or cardiovascular disease risk in familial hypercholesterolemia patients. PMID: 25525746
  • The prognostic value of AnV and T cell apoptosis was evaluated in children with nephrotic syndrome in this review. PMID: 25661914
  • study found neither individual SNPs nor any of the four haplotypes within the ANXA5 gene upstream region were associated with deep venous thrombosis in the Dutch population PMID: 25382354
  • Lower incidence of M2/ANXA5 carriage in recurrent pregnancy loss patients with elevated lipoprotein(a) levels. PMID: 24335248
  • Polycystic ovary syndrome subjects showed increased annexin V positive microparticle concentrations compared with healthy volunteers. PMID: 25336711
  • Annexin A5 inhibits DLBCL cell invasion, MMP-9 expression/activity, and chemoresistance to CHOP through a PI3K-dependent mechanism. PMID: 25323007
  • Data show involvement of ANXA5 and ILKAP in susceptibility to malignant melanoma PMID: 24743186
  • annexin A5 promotes GBM cell invasion, MMP-2 expression/activity, and chemoresistance to temozolomide through a PI3K-dependent mechanism. PMID: 25245332
  • Modified forms of LDL activate human T cells through dendritic cells. Annexin A5 inhibits these effects and promotes induction of regulatory T cells. PMID: 25395618
  • The annexin 5 in serums of pregnant women and patients with particular types of cancer PMID: 25080795
  • This review describes the structure, function and genetic expression of ANXA5, as well as its possible implication in recurrent pregnancy loss. PMID: 24152411
  • We could not prove any association of ANX5 antibodies and systemic lupus erythematosis. PMID: 24872142
  • genetic association studies in population in Japan: Data suggest that hypomorphic alleles in ANXA5 promoter in placenta (that is, fetal alleles), but not in maternal blood, contributes to onset of pre-eclampsia. PMID: 24140079
  • This study demonstrated the significant changes in AnxV levels and its function in type 1 diabetic patients. PMID: 24423325
  • Annexin A5 binds in a cooperative manner to to phosphatidylserine on apoptotic cell membranes. Shrunken apoptotic cells showed the highest Hill coefficient values. PMID: 24304966
  • frequency of annexin A5 (-1C/T) polymorphism was higher in systemic lupus erythematosus related groups but did not correlate with recurrent pregnancy loss (RPL) or annexin A5 level; anti-annexin A5 IgM level was higher among antiphospholipid syndrome patients and was associated with RPL PMID: 24600987
  • Annexin-V modified substrate was constructed via layer-by-layer (LBL) method for specific capture of early stage apoptotic Jurkat cells. PMID: 24021657
  • annexin A5 may play a crucial role in cisplatin-induced toxicity by mediating the mitochondrial apoptotic pathway via the induction and oligomerization of VDAC. PMID: 24318879
  • Suggest that annezin A5 IgG plays a significant role in producing a hypercoagulable state in primary and secondary antiphospholipid syndrome. PMID: 23981755
  • Variations within the ANXA5 gene upstream region were confirmed to be risk factors of recurrent pregnancy loss. PMID: 23850300
  • rs11575945 polymorphism of the annexin-A5 gene is associated with schizophrenia, and its minor allele is responsible for higher levels of the annexin-A5 protein in the blood and represent one of the risk factors for this disease PMID: 24466757
  • ANXA5 M2 haplotpye appears as an recurrent pregnany loss risk factor in male and female carriers with most distinguishable effects between the 10th and 15th week of gestation. PMID: 23899942
  • It appears that the haplotype M2/ANXA5 is not associated with the presence of anti-trophoblast antibodies. PMID: 23529182
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed