Recombinant Human Ankyrin-3 (ANK3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06769P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Ankyrin-3 (ANK3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06769P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Ankyrin-3 (ANK3) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q12955 |
| Target Symbol | ANK3 |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | C-6His |
| Target Protein Sequence | ERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDG |
| Expression Range | 4088-4199aa |
| Protein Length | Partial |
| Mol. Weight | 14.1 kDa |
| Research Area | Neuroscience |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | In skeletal muscle, required for costamere localization of DMD and betaDAG1. Membrane-cytoskeleton linker. May participate in the maintenance/targeting of ion channels and cell adhesion molecules at the nodes of Ranvier and axonal initial segments. Regulates KCNA1 channel activity in function of dietary Mg(2+) levels, and thereby contributes to the regulation of renal Mg(2+) reabsorption.; May be part of a Golgi-specific membrane cytoskeleton in association with beta-spectrin. |
| Subcellular Location | Cytoplasm, cytoskeleton. Cell projection, axon. Cell membrane, sarcolemma. Cell junction, synapse, postsynaptic cell membrane. Lysosome. Cell membrane, sarcolemma, T-tubule.; [Isoform 5]: Cytoplasm, cytoskeleton. Golgi apparatus. |
| Database References | HGNC: 494 OMIM: 600465 KEGG: hsa:288 STRING: 9606.ENSP00000280772 UniGene: PMID: 29109170 |
