Recombinant Human Angiotensin II Type 2 Receptor / AGTR2 Protein
Beta LifeScience
SKU/CAT #: BLA-12151P
Recombinant Human Angiotensin II Type 2 Receptor / AGTR2 Protein
Beta LifeScience
SKU/CAT #: BLA-12151P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | AGTR 2 Agtr2 AGTR2_HUMAN angiotensin II receptor type 2 Angiotensin II type-2 receptor Angiotensin receptor 2 AT 2 AT2 ATGR 2 ATGR2 MRX 88 MRX88 Type 2 angiotensin II receptor Type-2 angiotensin II receptor |
Description | Recombinant Human Angiotensin II Type 2 Receptor / AGTR2 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLDAIPIL YYIIFVIGFLVNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLW ATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPF LSQRRNPWQASYIVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFP PEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRIT RDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLAL PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESMSCR KSSSLREMETFVS |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |