Recombinant Human Angiotensin Converting Enzyme 1 / ACE1 Protein
Beta LifeScience
SKU/CAT #: BLA-12149P
Recombinant Human Angiotensin Converting Enzyme 1 / ACE1 Protein
Beta LifeScience
SKU/CAT #: BLA-12149P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | ACE ACE 1 ACE T ACE_HUMAN ACE1 Angiotensin converting enzyme somatic isoform Angiotensin converting enzyme testis specific isoform Angiotensin I converting enzyme Angiotensin I converting enzyme 1 Angiotensin I converting enzyme peptidyl dipeptidase A 1 angiotensin I converting enzyme peptidyl-dipeptidase A 1 transcript Angiotensin-converting enzyme Carboxycathepsin CD 143 CD143 CD143 antigen DCP DCP 1 DCP1 Dipeptidyl carboxypeptidase 1 Dipeptidyl carboxypeptidase I Kininase II MGC26566 MVCD3 Peptidase P Peptidyl dipeptidase A soluble form Testicular ECA |
Description | Recombinant Human Angiotensin Converting Enzyme 1 / ACE1 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | RLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELH GEKLGWPQYNWTPNSDDFYNETETKIFLQFYDQTGIWDHGAPHLLPPSQA RGTREAPVYM |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |