Recombinant Human Angiopoietin-Like Protein 8 (ANGPTL8) Protein (His)

Beta LifeScience SKU/CAT #: BLC-05088P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Angiopoietin-Like Protein 8 (ANGPTL8) Protein (His)

Beta LifeScience SKU/CAT #: BLC-05088P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Angiopoietin-Like Protein 8 (ANGPTL8) Protein (His) is produced by our Baculovirus expression system. This is a full length protein.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb Q6UXH0
Target Symbol ANGPTL8
Synonyms ANGPTL8; C19orf80; RIFL; UNQ599/PRO1185Angiopoietin-like protein 8; Betatrophin; Lipasin; Refeeding-induced fat and liver protein
Species Homo sapiens (Human)
Expression System Baculovirus
Tag N-10His
Target Protein Sequence APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA
Expression Range 22-198aa
Protein Length Full Length of Mature Protein
Mol. Weight 22.4 kDa
Research Area Cell Biology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Hormone that acts as a blood lipid regulator by regulating serum triglyceride levels. May be involved in the metabolic transition between fasting and refeeding: required to direct fatty acids to adipose tissue for storage in the fed state.
Subcellular Location Secreted.
Protein Families ANGPTL8 family
Database References

HGNC: 24933

OMIM: 125853

KEGG: hsa:55908

STRING: 9606.ENSP00000252453

UniGene: PMID: 28600576

  • Inhibition of miR-143-3p amplified ANGPTL8 response to treatments (glucose, insulin, Lipopolysaccharides), suggesting that the miRNA acts to suppress ANGPTL8 expression under metabolically distorted conditions. PMID: 30261196
  • Study suggests that ANGPTL8 levels in early pregnancy are significantly and independently associated with risk of GDM at 24-28 weeks of gestation. PMID: 29167926
  • Circulating full-length ANGPTL8 concentrations in patients with dyslipidemia were significantly elevated as compared to controls. PMID: 30021605
  • ApoCIII may mediate the effects of ANGPTL8 on triglyceride metabolism. PMID: 30021607
  • Study shows that angiopoietin-like protein 8 (ANGPTL-8) was positively correlated with hepatocellular lipid content independent of obesity and insulin resistance, indicating that ANGPTL-8 might be a new and important important predictor of the severity of non-alcoholic fatty liver disease. PMID: 29266821
  • We conclude that serum betatrophin concentrations were increased in pregnancies affected by hyperemesis gravidarium. PMID: 29754072
  • Data suggest the angiopoietin-like 8 (ANGPTL8)/p62-IKKgamma axis as a negative feedback loop that regulates NF-kappaB activation, and extends the role of selective autophagy in fine-tuned inflammatory responses. PMID: 29255244
  • ANGPTL8 levels are increased in both plasma and adipose tissues of subjects with hypertension. PMID: 29490644
  • Serum ANGPTL8 concentrations were significantly increased in impaired glucose regulation and type 2 diabetes. PMID: 29082263
  • the level of circulating betatrophin is positively associated with insulin resistance. PMID: 28931172
  • we identified ANGPTL8 as the target gene at this HDL-C GWAS locus, determined regulatory drivers of tissue specificity, and combined fine-mapping approaches and regulatory overlap with experimental assays to identify variants that may contribute to the HDL-C GWAS signal at ANGPTL8. PMID: 28754724
  • serum levels not associated with weight status, glucose tolerance, insulin resistance, or lipid metabolism PMID: 27402552
  • Elevated betatrophin levels in polycystic ovary syndrome women, in the absence of obesity and glucose intolerance, may reflect a compensatory mechanism in order to counteract metabolic syndrome-related risk factors. PMID: 28319674
  • betatrophin levels appeared to be related to the pathogenesis of the diabetic stages rather than prediabetic stages. PMID: 28351091
  • Angiopoietin-like protein 8/betatrophin is related to liver steatosis, while visceral adipose tissue represents an additional site of expression in humans. PMID: 28351093
  • ANGPTL8 reverses established Adriamycin induced cardiomyopathy by stimulating adult cardiac progenitor cells. PMID: 27823982
  • Study provided an update to understand its physiological function from literature curated findings through an integrated view of ANGPTL8's regulation and its associated pathways. PMID: 28684091
  • betatrophin is increased in pancreatic cancer-associated diabetes PMID: 27276680
  • These results confirm a role for ANGPTL8 in lipoprotein metabolism and provide novel support for functional consequences of the rs2278426 variant. PMID: 27117576
  • ANGPTL8 has a functional LPL inhibitory motif, but only inhibits LPL and increases plasma TG levels in mice in the presence of ANGPTL3 PMID: 28413163
  • The inflammation-induced miR-221-3p regulates ANGPTL8 expression in adipocytes. This miRNA impact may become especially prominent under pathologic conditions such as morbid obesity, putatively contributing to the impaired adipose tissue lipid metabolism in metabolic disease. PMID: 28938482
  • Circulating ANGPTL8 increases after bariatric surgery and predicts type 2 diabetes remission in morbidly obese patients. PMID: 28347650
  • Data suggest that plasma betatrophin levels are significantly increased in lean (normal-weight) women with PCOS (polycystic ovary syndrome) compared to lean women without PCOS; plasma betatrophin levels are not significantly altered in overweight/obese women with PCOS compared to overweight/obese women without PCOS. This study was conducted in China. PMID: 27960599
  • Especially the association to eGFR highlights the importance for future studies to address renal function as possible influence on betatrophin regulation and consider eGFR as potential confounder when analyzing the role of betatrophin in humans PMID: 28257453
  • Serum betatrophin is an independent risk factor for nonalcoholic fatty liver and potential non-invasive marker for its progression. PMID: 28125672
  • Cord blood betatrophin may function as a potential biomarker of maternal intrauterine hyperglycemia and fetal insulin resistance, which may presage for long-term metabolic impact of gestational diabetes on offspring PMID: 27196053
  • The high levels of ANGPTL8 found in fetal life together with its relationship with newborn adiposity and brown adipose tissue point to ANGPTL8 as a potential new player in the modulation of the thermogenic machinery during the fetal-neonatal transition. PMID: 27469268
  • Betatrophin levels were increased in women with PCOS and were associated with insulin resistance, c-reactive protein, and free-testosterone in these patients. PMID: 26832343
  • Obesity is associated with increased betatrophin suppression after an oral glucose load; this response appears to be driven by hyperglycemia. Data suggest that the impaired betatrophin response in obese subjects is restored after weight loss and is comparable with the betatrophin response in lean individuals. PMID: 27459526
  • Serum betatrophin levels are increased and associated with insulin resistance in patients with polycystic ovary syndrome. PMID: 28222635
  • ANGPTL8/betatrophin might play an important role in glucose metabolism in the context of insulin resistance. PMID: 26387753
  • This study supports that serum betatrophin plays an important role in MetS, involving the regulations of glucose and lipid metabolism and inflammation. PMID: 27238790
  • our data shows that ANGPTL3, 4 and 8 are increased in obesity and type 2 diabetes (T2D). ANGPTL8 associates with ANGPTL3 in the non-diabetic subjects while it associated more with ANGPTL4 in the obese and T2D subjects. PMID: 27733177
  • circulating betatrophin is increased in mice and humans with NAFLD and its expression was induced by endoplasmic reticulum stress in hepatocytes PMID: 27045862
  • High betatrophin expression is associated with diabetic metabolic syndrome. PMID: 27578619
  • Elevated betatrophin levels were associated with cardiometabolic risk factors a young population, but the association was largely dependent on vitamin D status. PMID: 27716289
  • betatrophin may be associated with thyroid insufficiency but not thyroid autoimmunity. PMID: 27213151
  • Betatrophin levels in patients with polycystic ovary syndrome (PCOS) are lower than those without PCOS and inversely related to insulin resistance. PMID: 27188865
  • data shows for the first time that heterozygote form of ANGPTL8 Rs.2278426 variant was associated with higher FBG level in Arabs highlighting the importance of these variants in controlling the function of betatrophin. PMID: 26864934
  • Serum betatrophin concentrations are increased in type 2 diabetes patients under antidiabetic treatment and positively associated with diabetic retinopathy. PMID: 26863068
  • Compared with type 2 diabetes without cardiovascular disease (CVD), patients with CVD had remarkably higher levels of angiopoietin-like protein 8 (ANGPTL8). PMID: 27596060
  • Circulating betatrophin concentration is negatively correlated with insulin resistance in obese children and adolescents. PMID: 27103367
  • Meta-analysis results from case control studies on betatrophin and type 2 diabetes (T2DM) revealed increased circulating levels of betatrophin in patients with T2DM. PMID: 27242389
  • ANGPTL8 levels were associated with baseline and future changes in triglyceride levels in Korean children. PMID: 26739706
  • Betatrophin is significantly increased in T2DM patients with different stages of albuminuria. Betatrophin may be a novel endocrine regulator involved in DN development. PMID: 26739836
  • ANGPTL8 is increased in subjects with MetS and it was significantly associated with HsCRP levels in different subgroups. PMID: 26850725
  • Disruption of ANGPTL8 function in humans does not seem to have a large effect on measures of glucose tolerance. PMID: 26822414
  • Based on the findings of our meta-analysis, circulating betatrophin level of T2DM patients is higher than that of nondiabetic adults in the nonobese population, but not in the obese population. PMID: 26697500
  • In patients with diabetes mellitus type 2, betatrophin levels did not correlate with beta-cell function-related variables or insulin resistance-related variables PMID: 26649318
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed