Recombinant Human Angiopoietin-2 (ANGPT2) Protein (His), Active

Beta LifeScience SKU/CAT #: BLC-05763P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.
Activity Measured by its binding ability in a functional ELISA. Immobilized Human ANGPT2 at 2 μg/ml can bind anti-ANGPT2 recombinant antibody, the EC 50 is 0.6666-0.8876 ng/mL. Biological Activity Assay
Activity Measured by its binding ability in a functional ELISA. Immobilized Human ANGPT2 at 2 μg/ml can bind anti-ANGPT2 recombinant antibody, the EC 50 is 0.6666-0.8876 ng/mL. Biological Activity Assay

Recombinant Human Angiopoietin-2 (ANGPT2) Protein (His), Active

Beta LifeScience SKU/CAT #: BLC-05763P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description Recombinant Human Angiopoietin-2 (ANGPT2) Protein (His), Active is produced by our Mammalian cell expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/ug as determined by LAL method.
Activity Measured by its binding ability in a functional ELISA. Immobilized Human ANGPT2 at 2 μg/mL can bind anti-ANGPT2 recombinant antibody, the EC 50 is 0.6666-0.8876 ng/mL.
Uniprotkb O15123
Target Symbol ANGPT2
Synonyms (ANG-2)
Species Homo sapiens (Human)
Expression System Mammalian cell
Tag C-10His
Target Protein Sequence YNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Expression Range 19-496aa
Protein Length Full Length of Mature Protein
Mol. Weight 56.3 kDa
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating ANGPT1 signaling. Can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression. In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal.
Subcellular Location Secreted.
Database References

Gene Functions References

  1. plasma ANG-2 level, the acute physiology and chronic health evaluation 2 (APACHE2) score and lung injury prediction score are correlated with acute respiratory distress syndrome PMID: 30008611
  2. Study is the first to demonstrate that Ang2 is upregulated not only in the local skin lesions but also in the systemic circulation, and that its serum levels correlate well with disease severity in psoriasis vulgaris patients. PMID: 28497874
  3. regulatory mechanisms of Ang-2 in NSCLC PMID: 30454550
  4. This study demonstrates that Ang-2 levels are significantly upregulated in sepsis-associated coagulopathy (SAC), and this biomarker can be used to risk stratify patients with sepsis into non-overt disseminated intravascular coagulation (DIC) and overt DIC. PMID: 29996658
  5. Flunarizine protected ECs from TNFalpha-induced increase in Angpt-2 transcription and vascular barrier breakdown. PMID: 28276491
  6. Study findings delineate the existence of the beta-estradiol (E2)-ANGPT2 axis in hair follicles and suggest that, by substituting E2, ANGPT2 may provide a novel strategy for the treatment of postmenopausal female pattern hair loss. PMID: 29724581
  7. Results suggest that hCPFs-Exo transports low expressed exosomal miR-106b-5p to endothelial cells and promotes angiogenesis by overexpression of Angpt2. PMID: 29905392
  8. Angpt2 is an independent predictor of adverse clinical outcomes in diabetic patients. Further studies are needed to identify the pathogenic role of Angpt2 in renal deterioration and cardiovascular complications of diabetes mellitus. PMID: 29642068
  9. High ANG2 expression is associated with Acute respiratory distress syndrome. PMID: 30171880
  10. PVT1 was able to bind and degrade miR26b to promote connective tissue growth factor (CTGF) and angiopoietin 2 (ANGPT2) expression. PMID: 29620147
  11. Serum Ang-2 may be a useful tumor marker in predicting liver cancer prognosis. PMID: 29253494
  12. High ANG2 expression is associated with angiogenesis in breast cancer. PMID: 28534941
  13. Angiopoietin-2 acts as a survival factor for chronic lymphocytic leukemia B cells throughout Tie-2 receptor engagement. PMID: 28580615
  14. serum level elevated in pre-eclampsia, not significantly affected by HIV status PMID: 28627965
  15. Plasma levels of Ang2 were associated with markers of malaria severity and levels of var transcripts encoding P. falciparum Erythrocyte Membrane Protein 1 (PfEMP1) containing Cysteine Rich Inter Domain Region alpha1 (CIDRalpha1) domains predicted to bind Endothelial Protein C receptor (EPCR). PMID: 27784899
  16. Hepatitis C virus induces Ang2 expression in hepatocytes. PMID: 28027429
  17. the relationship between lung cancer stage and Ang 2 was documented with this study and the expression rate was found to be lower in adenocarcinomas. By this analysis, we can suggest that angiopoietins may be used as an option for targeted treatment in lung cancer. PMID: 27811442
  18. Endothelial glycocalyx breakdown is mediated by Angpt-2 in a non-redundant manner. PMID: 28453727
  19. The relation between angiopoietin-2 and assessed parameters of vascular structure in type 1 diabetes reflects a state of endothelial injury and highlights the role of disturbed angiogenesis and vascular inflammation in the occurrence of diabetic complications. PMID: 27236773
  20. Results show that MiR-93 targets Ang2 3' UTR and regulates its expression in lung adenocarcinoma. PMID: 28401709
  21. We demonstrate that ANGPT2 signaling activated after estrogen depletion paradoxically triggers ER+ tumor cell awakening from dormancy in their BM niche, partly indirectly via endothelial Tie2 receptor and partly directly via tumor cell surface integrin &1. PMID: 27353038
  22. ANG2 did not affect apoptosis or the cell cycle. In contrast, in the in vivo system, overexpression of ANG2 increased tumor growth. PMID: 27492854
  23. the optimal discrimination cut-off for each cytokine: sVEGFR-1 (2124.5pg/mL), IL-6 (40.2pg/mL), VEGF-A (1060.1pg/mL), Angiopoeintin-2 (913.7pg/mL), uPA (248.1pg/mL), sHER-2/neu (5010pg/mL) and PLGF (93.4pg/mL). For the very first time, a novel cytokine profile associated with cancer metastasis to the paratracheal lymph nodes were reported. PMID: 27599390
  24. Gab1/SHP2/p38MAPK signaling pathway and Ang-2 have an essential role in regulating thrombin-induced monocyte adhesion and vascular leakage PMID: 27241812
  25. This study demonstrated that ANGPT2 higher expression in glioblastoma. PMID: 27633774
  26. These observations provide the first evidence for positive regulation of osteogenesis by ANGPT2 in vitro. PMID: 28214341
  27. in vitro is has also been shown that Angpt-2 can act as a dose-dependent Tie2 agonist/antagonist. PMID: 27038015
  28. Ang-2 and sTie-2 plasma levels are increased in pediatric OSA and obesity, particularly when endothelial dysfunction or insulin resistance is detectable. PMID: 28474375
  29. pathways for two distinctive secretory mechanisms, constitutive and stimulated, of Ang-2 in pulmonary microvascular endothelial cells. PMID: 27585839
  30. High ANG2 expression is associated with angiogenesis and metastasis via IGF1-IGF1R signaling in epithelial ovarian cancer. PMID: 28898232
  31. Our novel noninvasive liver fibrosis model, based on serum angiopoietin-2 levels, outperforms other indices and should help substantially in managing CHC and monitoring long-term follow-up prognosis PMID: 23823085
  32. Tie1 directly interacts with Tie2 to promote ANG-induced vascular responses under noninflammatory conditions, whereas in inflammation, Tie1 cleavage contributes to loss of ANG2 agonist activity and vascular stability PMID: 27548530
  33. This systematic review and meta-analysis suggested that serum Ang-2 levels might be a potential predictor for staging, and were associated with prognosis of lung cancer. PMID: 28906403
  34. Studied angiopoietin-1 (Ang-1) and angiopoietin-2 (Ang-2) within the intervertebral disc (IVD) and elucidated their functions in the regulation of nucleus pulposus (NP) cells. Found the ratio of Ang-2/Ang-1 in tissues from patients increased markedly with increasing age and level of degeneration of the IVD. Results indicate Ang-2 plays a role in suppressing cell adhesion&viability, and promotes the apoptosis of NP cells. PMID: 28394321
  35. Analyses of human gastric cancer tissues showed a strong correlation between DARPP-32 and ANGPT2. The role of DARPP-32-STAT3 axis in regulating ANGPT2 in cancer cells to promote angiogenesis and tumorigenesis. PMID: 25779598
  36. ANGPT2 expression was upregulated in cerebral cavernous malformation lesions. PMID: 27548575
  37. Linkage analysis identified a peak (LOD = 4.29) on chromosome 8p23. Follow-up association analysis identified two haplotypes in angiopoietin-2 (ANGPT2) that significantly contributed to the variation of SaO2 (P = 8 x 10-5) and accounted for a portion of the linkage evidence. PMID: 27798093
  38. Blood ANGPT2 was significantly higher in chronic hepatitis C patients with liver fibrosis compared to those without fibrosis. PMID: 27930387
  39. This study reveals ANGPT2 as a new susceptibility gene for nAMD and PCV, and it may affect disease susceptibility in association with CFH. PMID: 28192798
  40. These results underscore a pivotal role of Kaposi's sarcoma-associated herpesvirus -induced Ang-2 in KS tumor development by promoting both angiogenesis and inflammation. PMID: 27294705
  41. Data suggest that the associations among angiopoietin-2, sFlt-1, coagulation abnormalities and severe course of acute pancreatitis (AP) might be mediated by other bioactive compounds. PMID: 28368336
  42. An imbalance in ANGPT-2, combined with related factors such as VEGF, beta-catenin, and MMP-2, may partially explain the structural derangements of the arterial wall in patients with chronic obstructive pulmonary disease. PMID: 26801565
  43. Results demonstrate that Ang-2 expression significantly correlated with poor prognosis for patients with non-small cell lung cancer. [meta-analysis] PMID: 27589869
  44. Our results show that miR-181a is down-regulated in glioblastoma multiforme (GBM) patients. The three target genes, ANGPT2, ARHGAP18 and LAMC1, are negatively correlated with the expression of miR-181a. Moreover, high expression of ANGPT2 or LAMC1 together with large size of GBM is correlated with a shorter median overall survival PMID: 27176932
  45. These results suggested that IL-35 restrains rheumatoid arthritis angiogenesis and inflammation by downregulating basal and VEGF-induced Ang2 secretion as well as disrupting Ang2/Tie2 signal transduction. PMID: 27960151
  46. This study identified Ang-2 as an endothelial cell-derived regulator of BBB permeability. PMID: 26932603
  47. Serum Ang-2 may be a relevant predictor of Acute Pancreatitis severity, in particular of the development of AP-renal syndrome. PMID: 27022209
  48. Data show that angiopoietin-2 (Ang-2) and bacterial endotoxins (LPS) follow opposite kinetics in serum in acute pyelonephritis. PMID: 26844659
  49. IL-19 and Ang-2 might be involved in angiogenesis of T2 Diabetes mellitus complications. PMID: 26657726
  50. Compared with patients with heart failure or those with orthotopic heart transplantation, serum levels and endothelial expression of Ang-2 were higher in LVAD patients. Ang-2 may contribute to arteriovenous malformation formation and subsequent bleeding in LVAD patients. PMID: 27354285

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed