Recombinant Human Anaphase-Promoting Complex Subunit 10 (ANAPC10) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08651P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Anaphase-Promoting Complex Subunit 10 (ANAPC10) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08651P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Anaphase-Promoting Complex Subunit 10 (ANAPC10) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9UM13 |
| Target Symbol | ANAPC10 |
| Synonyms | ANAPC 10; anapc10; Anaphase promoting complex 10; Anaphase promoting complex subunit 10; Anaphase-promoting complex subunit 10; Apc 10; APC10; APC10_HUMAN; Cyclosome subunit 10; DKFZP564L0562; Doc 1; Doc1; Doc1; S. cerevisiae; homolog of; OTTHUMP00000220297; OTTHUMP00000220298; OTTHUMP00000220299; OTTHUMP00000220300; OTTHUMP00000220303 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | TTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR |
| Expression Range | 1-185aa |
| Protein Length | Full Length |
| Mol. Weight | 48.1kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. |
| Protein Families | APC10 family |
| Database References | HGNC: 24077 OMIM: 613745 KEGG: hsa:10393 STRING: 9606.ENSP00000310071 UniGene: PMID: 21336306 |
