Recombinant Human Alpha-Ketoglutarate-Dependent Dioxygenase Alkb Homolog 3 (ALKBH3) Protein (His-SUMO)

Name: Recombinant Human Alpha-Ketoglutarate-Dependent Dioxygenase Alkb Homolog 3 (ALKBH3) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-10144P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Alpha-Ketoglutarate-Dependent Dioxygenase Alkb Homolog 3 (ALKBH3) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q96Q83
Target Symbol	ALKBH3
Synonyms	1700108H04Rik ; 1810020C19Rik; ABH3; AlkB homolog 3; alkB; alkylation repair homolog 3 (E. coli); ALKB3_HUMAN; ALKBH3; Alkylated DNA repair protein alkB homolog 3; alkylation repair homolog 3; Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3; DEPC 1; DEPC-1; DEPC1; EC 1.14.11.; FLJ43614; mABH3; MGC118790; MGC118792; MGC118793; MGC134125 ; PCA1; Prostate cancer antigen 1; Prostate cancer antigen-1; RP23-375N21.4
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	MEEKRRRARVQGAWAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLSDREFVFKEPQQVVRRAPEPRVIEEGVYEISLSPTGVSRVCLYPGFVDVKEADWILEQLCQDVPWKQRTGIREDSILQLTFKKSAPVSGTATAPQSCWYERPSPPHIPGPAILTRTRLWAP
Expression Range	1-170aa
Protein Length	Full Length of Isoform 2
Mol. Weight	35.3kDa
Research Area	Epigenetics And Nuclear Signaling
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Dioxygenase that mediates demethylation of DNA and RNA containing 1-methyladenosine (m1A). Repairs alkylated DNA containing 1-methyladenosine (m1A) and 3-methylcytosine (m3C) by oxidative demethylation. Has a strong preference for single-stranded DNA. Able to process alkylated m3C within double-stranded regions via its interaction with ASCC3, which promotes DNA unwinding to generate single-stranded substrate needed for ALKBH3. Also acts on RNA. Demethylates N(1)-methyladenosine (m1A) RNA, an epigenetic internal modification of messenger RNAs (mRNAs) highly enriched within 5'-untranslated regions (UTRs) and in the vicinity of start codons. Requires molecular oxygen, alpha-ketoglutarate and iron.
Subcellular Location	Nucleus. Cytoplasm.
Protein Families	AlkB family
Database References	HGNC: 30141 OMIM: 610603 KEGG: hsa:221120 STRING: 9606.ENSP00000302232 UniGene: PMID: 28205560 ALKBH3 is a novel addition to the catalogue of DNA repair genes found inactivated in breast cancer. Our results underscore a link between defective alkylation repair and breast cancer which, additionally, is found in association with poor disease outcome. PMID: 28679371 The TP53 knockout shifted the phenotypes of A549 cells induced by ALKBH3 knockdown from cell cycle arrest to apoptosis induction, suggesting that the TP53 gene status is a critical determinant of the phenotypes induced by ALKBH3 knockdown in NSCLC cells. PMID: 28479246 These results revealed that N3-ethylthymidine , but not other DNA lesions, could be repaired by Alkbh2 and Alkbh3 in mammalian cells. PMID: 26930515 Results show that PCA1 expression was positively correlated with advanced stages in renal cell carcinoma and strongly suggest that PCA-1 may be functionally important and a novel molecular target for human renal cell carcinoma. PMID: 26035443 It was shown for first time that DNA glycosylase ALKBH3 can repair DNA adduct 3,N4-ethenocytosine from single-stranded DNA. PMID: 25797601 ALKBH3 contributes to development of urothelial carcinomas by accelerating their survival, angiogenesis, and invasion PMID: 22850567 ALKBH3 gene silencing markedly induces apoptosis in hormone-independent prostate cancer cell line DU145. PMID: 22515525 Our results establish PCA-1/ALKBH3 as important gene in pancreatic cancer PMID: 22826605 DNA unwinding by ASCC3 helicase is coupled to ALKBH3-dependent DNA alkylation repair and cancer cell proliferation. PMID: 22055184 ALKBH3 contributes significantly to cancer cell survival and may be a therapeutic target for human adenocarcinoma of the lung. PMID: 21285982 This work has provided a detailed understanding of the structural features of the single-stranded DNA and double-stranded DNA preferences of ABH2 and ABH3. PMID: 20714506 Divergent sequences outside of the active site determine substrate specificities of ABH3. PMID: 20525795 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 20970119 Crystallographic study reveals beta-strand jelly-roll fold of hABH3 that coordinates a catalytically active iron center by a conserved His1-X-Asp/Glu-X(n)-His2 motif [ABH3] PMID: 16858410 PCA-1 might be a novel diagnostic marker for prostate cancer, and increased PCA-1 expression might denote more aggressive variants of prostate cancer [PCA-1]. PMID: 17968469

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.