Recombinant Human Alpha 1 microglobulin / A1M Protein
Beta LifeScience
SKU/CAT #: BLA-12093P
Recombinant Human Alpha 1 microglobulin / A1M Protein
Beta LifeScience
SKU/CAT #: BLA-12093P
Collections: High-quality recombinant proteins, Other recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | A1M Alpha 1 microglobulin/bikunin precursor Alpha 1 microglycoprotein Alpha-1 microglycoprotein Alpha-1-microglobulin AMBP AMBP_HUMAN Bikunin Complex-forming glycoprotein heterogeneous in charge EDC1 Growth inhibiting protein 19 HCP HI-30 HI30 IATIL ITI ITI-LC ITIL Microglobulin (alpha 1) Protein AMBP Protein HC Trypstatin Uristatin Uronic-acid-rich protein UTI |
Description | Recombinant Human Alpha 1 microglobulin / A1M Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | AGPVPTPPDNIQVQGNFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTL VLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITM ESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVV AQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGG QLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNG NNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYG GCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |