Recombinant Human Aldo-Keto Reductase Family 1 Member C3 (AKR1C3) Protein (GST)

Name: Recombinant Human Aldo-Keto Reductase Family 1 Member C3 (AKR1C3) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-03998P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Aldo-Keto Reductase Family 1 Member C3 (AKR1C3) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P42330
Target Symbol	AKR1C3
Synonyms	17 beta HSD 5; 17 beta hydroxysteroid dehydrogenase type 5; 17-beta-HSD 5; 17-beta-hydroxysteroid dehydrogenase type 5; 2-dihydrobenzene-1; 2-diol dehydrogenase; 20 alpha-hydroxysteroid dehydrogenase; 20-alpha-hydroxysteroid dehydrogenase; 3 alpha hydroxysteroid dehydrogenase type II; 3-alpha-HSD type 2; 3-alpha-HSD type II; 3-alpha-HSD type II; brain; 3-alpha-hydroxysteroid dehydrogenase type 2; AK1C3_HUMAN; AKR1 C3; Akr1c18; AKR1C3; Aldo keto reductase family 1 member C3; Aldo-keto reductase family 1 member C3; brain; Chlordecone reductase; Chlordecone reductase homolog HAKRb; DD-3; DD3; DDH1; DDX; Dihydrodiol dehydrogenase 3; Dihydrodiol dehydrogenase type I; Dihydrodiol dehydrogenase X; HA1753; HAKRB; HAKRe; hluPGFS; HSD17B5; Indanol dehydrogenase; KIAA0119; PGFS; Prostaglandin F synthase; Testosterone 17-beta-dehydrogenase 5; Trans-1; Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; Type IIb 3 alpha hydroxysteroid dehydrogenase
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Expression Range	1-323aa
Protein Length	Full Length
Mol. Weight	63.9kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Cytosolic aldo-keto reductase that catalyzes the NADH and NADPH-dependent reduction of ketosteroids to hydroxysteroids. Acts as a NAD(P)(H)-dependent 3-, 17- and 20-ketosteroid reductase on the steroid nucleus and side chain and regulates the metabolism of androgens, estrogens and progesterone. Displays the ability to catalyze both oxidation and reduction in vitro, but most probably acts as a reductase in vivo since the oxidase activity measured in vitro is inhibited by physiological concentration of NADPH. Acts preferentially as a 17-ketosteroid reductase and has the highest catalytic efficiency of the AKR1C enzyme for the reduction of delta4-androstenedione to form testosterone. Reduces prostaglandin (PG) D2 to 11beta-prostaglandin F2, progesterone to 20alpha-hydroxyprogesterone and estrone to 17beta-estradiol. Catalyzes the transformation of the potent androgen dihydrotestosterone (DHT) into the less active form, 5-alpha-androstan-3-alpha,17-beta-diol (3-alpha-diol). Displays also retinaldehyde reductase activity toward 9-cis-retinal.
Subcellular Location	Cytoplasm.
Protein Families	Aldo/keto reductase family
Database References	HGNC: 386 OMIM: 603966 KEGG: hsa:8644 STRING: 9606.ENSP00000369927 UniGene: PMID: 29920533 AKR1C3 is a novel epithelial-mesenchymal transition driver in prostate cancer metastasis through activating ERK signaling. PMID: 30139661 The GG genotype of AKR1C3 rs10508293 is associated with decreased risk for preeclampsia. PMID: 29777907 AKR1C3 transcriptional regulation and its role in prostate cancer progression [review] PMID: 28359237 Overexpression of AKR1C3 could result in the accumulation of prostaglandin F2alpha (PGF2alpha), which can not only promote prostate cancer cell 's proliferation but also could enhance prostate cancer cells resistance to radiation. PMID: 27385003 The replacement of C154 with a residue possessing a bulky aromatic side-chain impairs the folding of the alpha-helix containing C154 and its neighboring secondary structures, leading to low thermostability of AKR1C3. PMID: 28025170 Data suggest that, in breast cancer cells, expression of HSD17B5 and expression of GRP78 (an apoptosis inhibitor) are strongly but negatively correlated; GRP78 knockdown decreases breast cancer cell viability whereas HSD17B5 knockdown increases cell viability and cell proliferation. (HSD17B5, 17-beta-hydroxysteroid dehydrogenase 5; GRP78, 78 kDa glucose-regulated protein) PMID: 28457968 AKR1C3 is the primary enzyme and CBR1 is a minor enzyme responsible for warfarin reduction in human liver cytosol. PMID: 27055738 the present study suggests that AKR1C1, AKR1C2, AKR1C3, and AKR1C4 are closely associated with drug resistance to both CDDP and 5FU, and that mefenamic acid, an inhibitor of AKR1C, restores sensitivity through inhibition of drug-resistance in human cancer cells. PMID: 28259989 a variant in the promoter region of HSD17B5 related to fetal androgen synthesis influences the genital phenotype in 21-Hydroxylase Deficiency females. PMID: 27082632 Five common AKR1C3 polymorphisms were associated with decreased rates of exemestane catalysis. PMID: 27111237 If our these findings can be reproduced in larger homogeneous cohorts, a genetic stratification based on the AKR1C3 rs12529 single nucleotide polymorphism, can minimize androgen deprivation therapy-related health-related quality of life effects in prostate cancer patients PMID: 27485119 We identified strong associations between the studied AKR1C3 variants and UBC risk. The homozygous variant genotype of rs12529 was found to be inversely associated with UBC, and rs1937920 was shown to be associated with increased risk of UBC. None of the genotypes were found to be significantly associated with tumor characteristics. PMID: 27085562 aldo-keto reductase 1C3-mediated prostaglandin D2 metabolism has a role in keloids PMID: 26308156 The results suggest that decreased expression of AKR1C3 may be involved in development of gastric cancer and can be restored by Sodium Butyrate. PMID: 27019068 AKR1C3 expression is elevated in prostate cancer cell lines and primary prostate cancer, suggesting a link between AKR1C3 levels and the epigenetic status in prostate cancer cells. PMID: 26429394 Aldo-keto reductase 1C3 is overexpressed in skin squamous cell carcinoma (SCC). AKR1C3 affects SCC growth via prostaglandin metabolism. PMID: 24917395 these results indicated that the actions of AKR1C3 can produce FP receptor ligands whose activation results in carcinoma cell survival in breast cancer. PMID: 26170067 and AKR1C3 may serve as a valuable therapeutic target in the treatment of castration-resistant prostate cancer PMID: 25754347 AKR1C3 activation is a critical resistance mechanism associated with enzalutamide resistance. PMID: 25649766 In the present study, crystal structures of complexes of HSD17B5 with structurally diverse inhibitors derived from high-throughput screening were determined. PMID: 25849402 AKR1C3 mRNA expression did not differ between bipolar disorder patients in any affective state or in comparison with healthy control subjects. PMID: 25522430 A catalysis-independent role for AKR1C3 on AR activity via Siah2 has been identified. PMID: 26160177 AKR1C3 mediated doxorubicin resistance might be resulted from the activation of anti-apoptosis PTEN/Akt pathway via PTEN loss. PMID: 25661377 Findings indicate the potential involvement of aldo-keto reductase AKR1C3 in the acquired radioresistance by AKR1C3 overexpression. PMID: 25419901 Higher expression of PLA2G2A, PTGS2, AKR1B1, AKR1C3 and ABCC4 was seen in 22-B endometriosis cells. PMID: 25446850 P450c17 and AKR1C3 inhibition may be an effective combinatorial treatment strategy. PMID: 25514466 AKR1C3 2 G allele carriers exhibited greater increases in heart rate and stimulant and sedative effects of alcohol than C allele homozygotes PMID: 24838369 Data suggest that reduction of daunorubicin/idarubicin is catalyzed by AKR1C3 and contributes to resistance of carcinoma cells to these anthracyclines; expression of AKR1C3 is induced in carcinoma cells following exposure to daunorubicin/idarubicin. PMID: 24832494 AKR1C3 can serve as a promising biomarker for the progression of prostate cancer PMID: 24571686 The -71G HSD17B5 variant is not a major component of the molecular pathogenetic mechanisms of PCOS, although it might contribute to the severity of hyperandrogenemia in women with PCOS and biochemical hyperandrogenism. PMID: 18692800 Significantly higher levels of SRD5A1, AKR1C2, AKR1C3, and HSD17B10 mRNA were however found in bone metastases than in non-malignant and/or malignant prostate tissue PMID: 24244276 Report expression of AKR1C3 in neuroendocrine tumors and adenocarcinomas of pancreas, gastrointestinal tract, and lung. PMID: 24228104 Silencing of AKR1C3 increases LCN2 expression and inhibits metastasis in cervical cancer. PMID: 24316309 Data indicate that fallopian tube and the epithelial component of Brenner tumours (BTs) expressed AKR1C3 and androgen receptor, but the tumour stromal cells showed strong expression of calretinin, inhibin and steroidogenic factor 1 in the majority of BTs. PMID: 24012099 Correlation of aldo-ketoreductase (AKR) 1C3 genetic variant with doxorubicin pharmacodynamics in Asian breast cancer patients. PMID: 23116553 examine the evidence that supports the vital role of AKR1C3 in CRPC and recent developments in the discovery of potent and selective AKR1C3 inhibitors PMID: 23748150 AKR1C3-mediated radioresistance in lung cancer cells is correlated with an arrest in the G2/M cell cycle and a decreased induction of apoptosis. PMID: 23519145 The involvement of up-regulated AKR1C1, AKR1C3 and proteasome in CDDP resistance of colon cancers. PMID: 23165153 Affect further reduction of 3-keto and 20-keto groups catalyzed by AKR1C2 and AKR1C3. PMID: 23183084 AKR1C3 can be considered a therapeutic target in a subgroup of patients with high AKR1C3 expression. PMID: 23196782 Our data suggest that there is no association of HSD17B6 and HSD17B5 variants with the occurrence of Polycystic Ovary Syndrome in the Chinese population PMID: 21039282 Activin A stimulates AKR1C3 expression and growth in human prostate cancer PMID: 23024260 AKR1C3 immunoreactivity was extensively present in both adenocarcinoma and squamous cell carcinoma arising from the lung and the gastroesophageal junction, but not in small cell carcinoma. PMID: 22670171 determined the X-ray crystal structure of AKR1C3 with the cofactor NADP+ and the drug-like inhibitor 3-phenoxybenzoic acid bound at a resolution of 1.68 A degrees in space group P212121 PMID: 22505408 AKR1C3 functions in differentiation-associated gene regulation and also has a role in supporting inflammation in atopic dermatitis. PMID: 22170488 Evidence of association of two alleles for alcohol dependence (AD) is found in SRD5A1 and AKR1C3, mediating a protective effect of the minor allele at each AD marker based on the genotype of the second marker. PMID: 21323680 the pro-proliferative action of AKR1C3 in HL-60 cells involves the retinoic acid signalling pathway and that this is in part due to the retinaldehyde reductase activity of AKR1C3 PMID: 21851338 role of AKR1C3 in the metabolism of testosterone and progesterone via the 5beta-reductase pathway. PMID: 21521174 enhanced metabolism of progesterone by SRD5A1 and the 20alpha-HSD and 3alpha/beta-HSD activities of AKR1C1, AKR1C2 and AKR1C3 PMID: 21232532

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.