Recombinant Human Aldo-Keto Reductase Family 1 Member C2 (AKR1C2) Protein (His-SUMO)
Recombinant Human Aldo-Keto Reductase Family 1 Member C2 (AKR1C2) Protein (His-SUMO)
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Description | Recombinant Human Aldo-Keto Reductase Family 1 Member C2 (AKR1C2) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P52895 |
| Target Symbol | AKR1C2 |
| Synonyms | 2-dihydrobenzene-1; 2-diol dehydrogenase; 3 alpha HSD3; 3 alpha hydroxysteroid dehydrogenase type III; 3-alpha-HSD3; AK1C2_HUMAN; AKR1C pseudo; AKR1C2; Aldo keto reductase family 1 member C2; Aldo-keto reductase family 1 member C2; BABP; Bile acid binding protein; Chlordecone reductase homolog; Chlordecone reductase homolog HAKRD; DD; DD-2; DD/BABP; DD2; DDH 2; DDH2; Dihydrodiol dehydrogenase 2; Dihydrodiol dehydrogenase/bile acid binding protein; Dihydrodiol dehydrogenase/bile acid-binding protein; FLJ53800; HAKRD; HBAB; MCDR 2; MCDR2; OTTHUMP00000044759; Pseudo chlordecone reductase; SRXY8; Trans 1 2 dihydrobenzene 1 2 diol dehydrogenase; Trans-1; Type II dihydrodiol dehydrogenase; Type III 3 alpha hydroxysteroid dehydrogenase; Type III 3-alpha-hydroxysteroid dehydrogenase |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY |
| Expression Range | 1-323aa |
| Protein Length | Full Length |
| Mol. Weight | 52.7kDa |
| Research Area | Metabolism |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Cytosolic aldo-keto reductase that catalyzes the NADH and NADPH-dependent reduction of ketosteroids to hydroxysteroids. Most probably acts as a reductase in vivo since the oxidase activity measured in vitro is inhibited by physiological concentrations of NADPH. Displays a broad positional specificity acting on positions 3, 17 and 20 of steroids and regulates the metabolism of hormones like estrogens and androgens. Works in concert with the 5-alpha/5-beta-steroid reductases to convert steroid hormones into the 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids. Catalyzes the inactivation of the most potent androgen 5-alpha-dihydrotestosterone (5-alpha-DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol). Also specifically able to produce 17beta-hydroxy-5alpha-androstan-3-one/5alphaDHT. May also reduce conjugated steroids such as 5alpha-dihydrotestosterone sulfate. Displays affinity for bile acids. |
| Subcellular Location | Cytoplasm, cytosol. |
| Protein Families | Aldo/keto reductase family |
| Database References | HGNC: 385 OMIM: 600450 KEGG: hsa:1646 STRING: 9606.ENSP00000370129 UniGene: PMID: 29369461 |

