Recombinant Human Agouti-Signaling Protein (ASIP) Protein (His-GST)

Name: Recombinant Human Agouti-Signaling Protein (ASIP) Protein (His-GST)
Brand: Beta LifeScience
SKU: BLC-01609P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Agouti-Signaling Protein (ASIP) Protein (His-GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P42127
Target Symbol	ASIP
Synonyms	ASP;Agouti switch protein
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-GST
Target Protein Sequence	HLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKKRSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCA
Expression Range	23-112aa
Protein Length	Partial
Mol. Weight	41.3 kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment). In higher primates, agouti may affect the quality of hair pigmentation rather than its pattern of deposition. Could well play a role in neuroendocrine aspects of melanocortin action. May have some functional role in regulating the lipid metabolism with adipocytes.
Subcellular Location	Secreted.
Database References	HGNC: 745 OMIM: 600201 KEGG: hsa:434 STRING: 9606.ENSP00000364092 UniGene: PMID: 28005267 Polymorphisms of ASIP were found to be associated with skin, hair, and eye color in a phenotypically diverse Brazilian population. More research is needed to determine its usefulness in forensic science. PMID: 25801600 ASIP gene mutation is involved in the development of facial pigmented lesions. PMID: 25705849 Data show that ASIP TG/TG diplotype, which is known to be associated with melanoma risk, was linked to a 5-fold increase in hazard of death from melanoma. PMID: 25382380 An increased risk of melanoma (odds ratio [OR] 1.27, 95% confidence interval [95% CI] 1.03-1.57) in carriers of the rs4911414 variant, located 120 kb upstream of ASIP. PMID: 22628150 By using a population-based material of high-risk melanoma cases, we demonstrate a significant effect of both MC1R red hair color (RHC) variants and an ASIP haplotype, but could not replicate an association with postulated risk SNPs of TYR and TYRP1. PMID: 22447455 Findings suggest that ASIP locus is associated with a number of non-melanoma skin cancers. PMID: 21221757 Further analysis of binding and functional data suggests that the ASIP C-terminal loop (a six-amino-acid segment closed by the final disulfide bond) is essential for high-affinity MC1R binding and inverse agonism. PMID: 20831872 polymorphism in the agouti signaling protein gene is associated with human pigmentation PMID: 11833005 results show that men and women of similar age and BMI present similar agouti signal protein mRNA levels in omental and subcutaneous abdominal adipocytes but a sexual dimorphism exists in the relationship between its expression and BMI PMID: 12055320 Results identify five genes that are down-regulated by agouti signalling protein (ASIP), indicating a likely role for ASIP in human melanogenesis. PMID: 12519127 Agouti mRNA levels significantly elevated in type 2 diabetes. Insulin did not regulate agouti mRNA. Agouti can regulate adipogenesis.There are functional consequences of elevated agouti levels in human adipose tissue. PMID: 14633851 Our study suggests that the ASIP G>A polymorphism exhibits a dominant effect leading to lighter skin color and that variation in the ASIP gene may have been one of several factors contributing to reductions in pigmentation in some populations. PMID: 15726415 ASIP polymorphism was not associated with pigmentation, nevi, or melanoma risk PMID: 15998953 An important role for exon 17b of ASIP in cancer cells was identified;alternative splicing isoforms ,hASIP-sa, hASIP-sb, had different effects on cell growth and Fas/FasL-mediated apoptosis in BEL-7404 human hepatoma cells. PMID: 16091846 A/G polymorphism in the 3'-UTR region of the agouti signaling protein contributes to dark pigmentation. PMID: 16704456 Cocaine- and amphetamine-regulated transcript protein is colocalized with this protein and neuropeptide Y in human hypothalamus. PMID: 17525122 ASIP and TYR pigmentation variants associate with cutaneous melanoma and basal cell carcinoma. PMID: 18488027 Two coding variants in TPCN2 are associated with hair color, and a variant at the ASIP locus shows strong association with skin sensitivity to sun, freckling and red hair. PMID: 18488028 ASIP polymorphism was found not to be associated with skin malignant melanoma or basal cell carcinoma. PMID: 18637131 Polymorphism of pigmentation genes (OCA2 and ASIP) in some populations of Russia PMID: 19382693 Single nucleotide polymorphisms in ASIP is associated with basal cell carcinoma PMID: 19384953

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.