Recombinant Human Advanced Glycosylation End Product-Specific Receptor (AGER) Protein (His)

Name: Recombinant Human Advanced Glycosylation End Product-Specific Receptor (AGER) Protein (His)
Brand: Beta LifeScience
SKU: BLC-03554P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Advanced Glycosylation End Product-Specific Receptor (AGER) Protein (His) is produced by our E.coli expression system. This is a extracellular protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q15109
Target Symbol	AGER
Synonyms	Advanced glycosylation end product-specific receptor; Ager; DAMA 358M23.4; MGC2235; MGC22357; RAGE_HUMAN; Receptor for advanced glycation end products; Receptor for advanced glycosylation end products
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLA
Expression Range	23-342aa
Protein Length	Extracellular Domain
Mol. Weight	38.0kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Mediates interactions of advanced glycosylation end products (AGE). These are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes. Acts as a mediator of both acute and chronic vascular inflammation in conditions such as atherosclerosis and in particular as a complication of diabetes. AGE/RAGE signaling plays an important role in regulating the production/expression of TNF-alpha, oxidative stress, and endothelial dysfunction in type 2 diabetes. Interaction with S100A12 on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key proinflammatory mediators. Interaction with S100B after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. Receptor for amyloid beta peptide. Contributes to the translocation of amyloid-beta peptide (ABPP) across the cell membrane from the extracellular to the intracellular space in cortical neurons. ABPP-initiated RAGE signaling, especially stimulation of p38 mitogen-activated protein kinase (MAPK), has the capacity to drive a transport system delivering ABPP as a complex with RAGE to the intraneuronal space. Can also bind oligonucleotides.
Subcellular Location	[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.; [Isoform 10]: Cell membrane; Single-pass type I membrane protein.
Database References	HGNC: 320 OMIM: 600214 KEGG: hsa:177 STRING: 9606.ENSP00000364217 UniGene: PMID: 28956473 High RAGE expression is associated with Breast Carcinoma. PMID: 30139236 AGEs increase IL-6 and ICAM-1 expression via the RAGE, MAPK and NF-kappaB pathways in HGFs and may exacerbate the progression of the pathogenesis of periodontal diseases. PMID: 29193068 Low serum sRAGE level is associated with Sarcopenia. PMID: 29271076 Results show that RAGE is activated by HMGB1 to induce EMT in prostate cancer cells. PMID: 29845254 Endogenous secretory receptor for advanced glycation end products protects endothelial cells from advanced glycosylation end-product associated apoptosis. PMID: 29850572 high mobility group box 1-receptor for advanced glycation end-products (HMGB1-RAGE) signaling pathway may be involved in the pathogenesis of preterm premature rupture of the membranes (pPROM). PMID: 29673663 Results show that RAGE is upregulated in breast cancer tissues, and confirmed that RAGE was a direct target of miR-328. PMID: 29620238 The results suggest that S100A12 does not participate in the induction of inflammation in dental pulp. However, RAGE can participate in the inflammation in the pulp of males. PMID: 28834384 The results show for the first time that RAGE is present in neuronally-derived plasma exosomes, and suggest that exosomal RAGE may be a novel biomarker that reflects pathophysiological processes in the brain. PMID: 29702093 Decreased soluble RAGE in neutrophilic asthma is correlated with disease severity and RAGE G82S variants. PMID: 29257350 Our study provides novel evidence for a potential role of AGER in bridging human papillomavirus (HPV)-induced inflammation and cervical cancer. PMID: 29298878 Plasmatic RAGE level is significantly lower in patients with prosthetic-joint-associated infections. PMID: 29386700 Inhibition of GLO1 in Glioblastoma Multiforme Increases DNA-AGEs, Stimulates RAGE Expression, and Inhibits Brain Tumor Growth in Orthotopic Mouse Models PMID: 29385725 a significant association between RAGE gene rs1800624 and rs1800625 polymorphisms and Age-related macular degeneration risk, is reported. PMID: 29317590 HMGB1 mediates fibroblast activity via RAGE-MAPK and NF-kappaB signaling in keloid scar formation. PMID: 29283384 Data revealed that hESC accumulates CML and RAGE under oxidative stress conditions in different ways than somatic cells, being the accumulation of CML statistically significant only in somatic cells and, conversely, the RAGE increase exclusively appreciated in hESC. PMID: 29104727 In women with Polycystic ovary syndrome(PCOS), the low ovarian levels of the anti-inflammatory sRAGE suggest that sRAGE could represent a biomarker and a potential therapeutic target for ovarian dysfunction in PCOS. Whether there is a direct causal relationship between sRAGE and vit D in the ovaries remains to be determined PMID: 28825156 current research highlighted the Glo-I/AGE/RAGE system as an interesting therapeutic target in chronic liver diseases. These findings need further elucidation in preclinical and clinical studies. PMID: 29156655 Low esRAGE expression is associated with bone Fractures. PMID: 29040721 Elevated sRAGE serum level is associated with further adverse events in patients with cardiovascular disease. PMID: 28864204 Our findings suggested that polymorphisms in the RAGE gene are involved in genetic susceptibility to Alzheimer disease but did not modify the risk of lewy body disease. PMID: 27699858 Findings suggest soluble Receptor for Advanced Glycation End products (sRAGE) protein from sRAGE-mesenchymal stem cells (MSC) has better protection against neuronal cell death than sRAGE protein or single MSC treatment by inhibiting the RAGE cell death cascade and RAGE-induce inflammation. PMID: 28760504 Protection against diabetic nephropathy in RAGE knockout mice is likely to be due in part to the decreased responsiveness to TGF beta stimulation and an antiapoptotic phenotype in mesangial cells. PMID: 29449307 the A allele of RAGE -374T/A polymorphism probably increase diabetic retinopathy risk (Meta-Analysis) PMID: 29451661 Advanced glycation end products decrease collagen I levels in fibroblasts from the vaginal wall of patients with pelvic organ prolapse via the RAGE, MAPK and NF-kappaB pathways. PMID: 28849117 we identified two risk-associated polymorphisms (rs1045411 and rs2070600), and more importantly a joint impact of seven polymorphisms from the HMGB1/RAGE axis in susceptibility to hepatocellular carcinoma PMID: 28187002 type 2 diabetes showed a higher cellular sensitivity for activation of receptor of advanced glycation end products. PMID: 27873077 the G82S variant of the RAGE gene was significantly associated with an increased risk of all-cause mortality and acute myocardial infarction in the Chinese Han population. PMID: 28660308 both RAGE and mitochondrial damage primed NLRP3 and pro-IL-1beta activation as upstream signals of NF-kappaB activity, whereas mitochondrial damage was critical for the assembly of inflammasome components. These results revealed that accumulation of AGEs in NP tissue may initiate inflammation-related degeneration of the intervertebral disc via activation of the NLRP3 inflammasome. PMID: 28224704 The main mechanism of Integrin alphaXbeta2 I-domain binding to RAGE is a charge interaction, in which the acidic moieties of Integrin alphaXbeta2 I-domains, including E244, and D249, recognize the basic residues on the RAGE V-domain encompassing K39, K43, K44, R104, and K107. PMID: 28535664 An overexpression of the receptor for RAGE was found in lesioned samples of patients with acquired reactive perforating collagenosis. PMID: 28474638 Single-nucleotide polymorphism in RAGE gene and high circulating soluble RAGE level is associated with diabetic kidney disease. PMID: 27448675 Significant association of the RAGE system with Hashimoto's thyroiditis was found only with regard to the prevalence of the -429T>C, but not with -374T>A polymorphism. PMID: 28226412 study revealed an early and constant increase of sRAGE level in the CSF of aneurysmal subarachnoid haemorrhage patients. PMID: 28630869 These data indicate that sRAGE may be involved in the initiation of beta-cell autoimmunity but not in the progression from beta-cell autoimmunity to clinical disease. PMID: 27883367 IL-23, alone and in combination with IL-18 and sRAGE, identified bacterial meningitis with excellent accuracy. Following validation, these markers could aid clinicians in diagnosis of bacterial meningitis and decision-making regarding prolongation of antibiotic therapy PMID: 29394248 meta-analysis aimed at investigating whether the RAGE rs2070600 polymorphism is associated with cancer risk PMID: 29421442 found that S100B plays a crucial role in blocking the interaction site between RAGE V domain and S100A1. A cell proliferation assay WST-1 also supported our results. This report could potentially be useful for new protein development for cancer treatment PMID: 29444082 Lower plasma sRAGE levels may be a biological measure of disease severity in idiopathic pulmonary fibrosis (IPF). Variation at the rs2070600 single-nucleotide polymorphism was not associated with IPF risk. PMID: 28248552 Results suggest a possible association between a functional polymorphism in AGER and IPF disease susceptibility, and indicate a potential prognostic value of circulatory sRAGE. PMID: 28198072 Thus, hypoxia not only increases RAGE expression in THP-1cells by promoting nuclear translocation of NF-kappa B and HIF1alpha, but also regulates chemotaxis and pro-inflammatory cytokines release, which may be partially mediated through upregulation of RAGE expression. PMID: 29258824 This study demonstrated that RAGE mRNA levels were significantly decreased in the new cases of untreated MS patients in comparison to healthy controls. IFN-beta 1a therapy results in upregulation of RAGE in MS patients. PMID: 28433998 High RAGE expression is associated with lung cancer. PMID: 26930711 findings collectively demonstrate that fasting blood sRAGE and esRAGE may be causally implicated in IGM in primary hypertensive patients PMID: 28974473 Our data suggest that the inhibition of sRAGE on I/R-induced apoptosis is associated with activation and expression of proteasome, including improved proteasome activity and elevated beta1i and beta5i expression mediated by STAT3 activation. We predict that sRAGE is a novel intervention to target UPS activation for preventing and treating myocardial apoptosis. PMID: 26878774 Receptor for AGE expression and reactive oxygen species production were upregulated in db/db mouse livers, together with impaired proteolytic, antioxidant and mitochondrial respiratory activities. In parallel, acute exposure of HepG2 cells to glycated albumin also elicited intracellular free radical formation PMID: 27890722 Our data suggest that H2S reduces RAGE dimer formation and impairs its membrane stability. The lowered plasma membrane abundance of RAGE therefore helps to protect cells against various RAGE mediated pathological effects. PMID: 28108276 Methylglyoxal-derived hydroimidazolone 1 evokes inflammatory reactions in human umbilical vein endothelial cells via receptor for advanced glycation end products. PMID: 28631505 Reduced values of sRAGE isoforms observed with both obesity and impaired glucose tolerance are independently associated with greater proportional odds of developing type 2 diabetes PMID: 28811295

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.