Recombinant Human Adenylate Kinase Isoenzyme 1 (AK1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10156P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Adenylate Kinase Isoenzyme 1 (AK1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10156P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Adenylate Kinase Isoenzyme 1 (AK1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P00568 |
Target Symbol | AK1 |
Synonyms | Adenylate kinase 1; Adenylate kinase isoenzyme 1; Adenylate kinase soluble; AK 1; Ak1; ATP AMP transphosphorylase; ATP-AMP transphosphorylase 1; KAD1; KAD1_HUMAN; Myokinase |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK |
Expression Range | 1-194aa |
Protein Length | Full Length |
Mol. Weight | 37.6kDa |
Research Area | Cardiovascular |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Also displays broad nucleoside diphosphate kinase activity. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism. |
Subcellular Location | Cytoplasm. |
Protein Families | Adenylate kinase family, AK1 subfamily |
Database References | HGNC: 361 OMIM: 103000 KEGG: hsa:203 STRING: 9606.ENSP00000362249 UniGene: PMID: 24495878 |