Recombinant Human Adenylate Kinase Isoenzyme 1 (AK1) Protein (His-SUMO)

Name: Recombinant Human Adenylate Kinase Isoenzyme 1 (AK1) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-10156P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Adenylate Kinase Isoenzyme 1 (AK1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P00568
Target Symbol	AK1
Synonyms	Adenylate kinase 1; Adenylate kinase isoenzyme 1; Adenylate kinase soluble; AK 1; Ak1; ATP AMP transphosphorylase; ATP-AMP transphosphorylase 1; KAD1; KAD1_HUMAN; Myokinase
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK
Expression Range	1-194aa
Protein Length	Full Length
Mol. Weight	37.6kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Also displays broad nucleoside diphosphate kinase activity. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.
Subcellular Location	Cytoplasm.
Protein Families	Adenylate kinase family, AK1 subfamily
Database References	HGNC: 361 OMIM: 103000 KEGG: hsa:203 STRING: 9606.ENSP00000362249 UniGene: Hs.175473
Associated Diseases	Hemolytic anemia due to adenylate kinase deficiency (HAAKD)

Gene Functions References

Studies indicate that the preferred substrate and phosphate donor of all adenylate kinases are AMP and ATP respectively. PMID: 24495878
Dysregulation of AMPK is both a pathogenic factor for these disorders in humans and a target for their prevention and therapy. [Review] PMID: 23863634
Ak(1)2-1 phenotype is more frequent in males conceived in the summer-autumn period than in those conceived in winter-spring, and this association depends on maternal Ak(1) phenotype. PMID: 23146316
identified hitherto unrecognized soluble forms of AK1 and NTPDase1/CD39 that contribute in the active cycling between the principal platelet-recruiting agent ADP and other circulating nucleotides PMID: 22637533
Data indicate that the neuronal adenylate kinase-1 (AK1) is induced by Abeta(42) to increase abnormal tau phosphorylation via AMPK-GSK3beta and contributes to tau-mediated neurodegeneration. PMID: 22419736
AK1 phenotypic activity is associated with birth weight and placental weight; these associations are greater in infants born at gestational age greater than 38 weeks. PMID: 21831515
Our findings suggest a reduced reproductive efficiency of women carrying the Ak(1)2-1 phenotype: this could have practical importance in predicting the probability of reproductive success in couples with RSA PMID: 22287021
The adipokine zinc-alpha2-glycoprotein activates AMP kinase in human primary skeletal muscle cells. PMID: 21457004
how mutations found in 2 patients may affect enzyme structure and function; a compound heterozygote for 2 different missense mutations 118G>A(Gly40Arg) and 190G>A(Gly64Arg); a homozygote for either aspartic acid (Asp) 140 or 141 PMID: 12649162
analysis of vascular endothelial ectoadenylate kinase and plasma membrane ATP synthase PMID: 16714292
The alpha-borano or alpha-H on PMEA and PMPA were detrimental to the activity of recombinant human AMP kinases 1 PMID: 18404568
The data suggest that zygotes carrying AK1*2 allele are relatively protected from the damaging effects of smoking PMID: 18850517

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.