Recombinant Human Adenovirus C Serotype 2 Early E3 18.5 Kda Glycoprotein Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01715P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Adenovirus C Serotype 2 Early E3 18.5 Kda Glycoprotein Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01715P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Adenovirus C Serotype 2 Early E3 18.5 Kda Glycoprotein Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P68978 |
| Target Symbol | P68978 |
| Synonyms | E3-19K E3gp 19 kDa Short name: E19 GP19K |
| Species | Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | AKKVEFKEPACNVTFKSEANECTTLIKCTTEHEKLIIRHKDKIGKYAVYAIWQPGDTNDYNVTVFQGENRKTFMYKFPFYEMCDITMYMSKQYKLWPPQKCLENTG |
| Expression Range | 18-123aa |
| Protein Length | Partial |
| Mol. Weight | 20.0 kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Binds and retains class I heavy chains in the endoplasmic reticulum during the early period of virus infection, thereby impairing their transport to the cell surface. Also delays the expression of class I alleles that it cannot affect by direct retention. Binds transporters associated with antigen processing (TAP) and acts as a tapasin inhibitor, preventing class I/TAP association. In consequence, infected cells are masked for immune recognition by cytotoxic T-lymphocytes. |
| Subcellular Location | Host endoplasmic reticulum membrane; Single-pass type I membrane protein. |
| Protein Families | Adenoviridae E19 family |
| Database References | KEGG: vg:2652987 |
