Recombinant Human Adenosine Receptor A2A (ADORA2A) Protein (His&My/His/Tag-Free)
Beta LifeScience
SKU/CAT #: BLC-11292P
Recombinant Human Adenosine Receptor A2A (ADORA2A) Protein (His&My/His/Tag-Free)
Beta LifeScience
SKU/CAT #: BLC-11292P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Adenosine Receptor A2A (ADORA2A) Protein (His&My/His/Tag-Free) is produced by our Baculovirus expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P29274 |
| Target Symbol | ADORA2A |
| Synonyms | A2AAR; A2aR; AA2AR_HUMAN; ADENO; Adenosine A2 receptor; Adenosine A2a receptor; Adenosine receptor A2a; Adenosine receptor subtype A2a; ADORA 2; ADORA2; ADORA2A; hA2aR; RDC 8; RDC8 |
| Species | Homo sapiens (Human) |
| Expression System | Baculovirus |
| Tag | N-His&C-Myc/N-His/Tag-Free |
| Target Protein Sequence | RIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGS APHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS |
| Expression Range | 291-412 |
| Protein Length | partial, Cytoplasmic domain |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. |
| Subcellular Location | Cell membrane; Multi-pass membrane protein. |
| Protein Families | G-protein coupled receptor 1 family |
| Database References | HGNC: 263 OMIM: 102776 KEGG: hsa:135 STRING: 9606.ENSP00000336630 UniGene: PMID: 29593213 |
