Recombinant Human A-Kinase Anchor Protein 4 (AKAP4) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08844P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human A-Kinase Anchor Protein 4 (AKAP4) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08844P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human A-Kinase Anchor Protein 4 (AKAP4) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q5JQC9 |
| Target Symbol | AKAP4 |
| Synonyms | A kinase (PRKA) anchor protein 4; A kinase anchor protein 4; A kinase anchor protein 82 kDa; A-kinase anchor protein 4; A-kinase anchor protein 82 kDa; AKAP 4; AKAP 82; AKAP-4; AKAP4; AKAP4_HUMAN; AKAP82; FSC 1; FSC1; hAKAP 82; hAKAP82; HI; Major sperm fibrous sheath protein; p82; PRKA 4; PRKA4; Protein kinase A anchoring protein 4; Protein kinase A-anchoring protein 4; Testis specific gene HI |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | QSPSAPPAKPPSTQRAVISPDGECSIDDLSFYVNRLSSLVIQMAHKEIKEKLEGKSKCLHHSICPSPGNKERISPRTPASKIASEMAYEAVELTAAEMRGTGEESREGGQKSFLYSELSNKSKSGDKQMSQRESKEFADSISKGLMVYANQVASDMMVSLMKTLKVHSSGKPIPASVVLKRVLLRHTKEIVSDLIDSCMKNLHNITGVLMTDSDFVSAVKRNLFNQWKQNATDIMEAMLKRLVSALIGEEKETKSQSLSYASLKAGSHDPKCRNQSLEFSTMKAEMKERDKGKMKSDPCKSLTSAEKVGEHILKEGLTIWNQKQGNSCKVATKACSNKDEKGEKINASTDSLAKDLIVSALKLIQYHLTQQTKGKDTCEEDCPGSTMGYMAQSTQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIVLMLIQKLLNENPFKCEDPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQANGQFIDKLVESVMKLCLIMAKYSNDGAALAELEEQAASANKPNFRGTRCIHSGAMPQNYQDSLGHEVIVNNQCSTNSLQKQLQAVLQWIAASQFNVPMLYFMGDKDGQLEKLPQVSAKAAEKGYSVGGLLQEVMKFAKERQPDEAVGKVARKQLLDWLLANL |
| Expression Range | 189-854aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 77.3kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Major structural component of sperm fibrous sheath. Plays a role in sperm motility. |
| Subcellular Location | Cell projection, cilium, flagellum. Note=Localizes to the principle piece of the sperm flagellum. |
| Protein Families | AKAP110 family |
| Database References | HGNC: 374 OMIM: 300185 KEGG: hsa:8852 STRING: 9606.ENSP00000351327 UniGene: PMID: 29581387 |
