Recombinant Human A Disintegrin And Metalloproteinase With Thrombospondin Motifs 4 (ADAMTS4) Protein (GST)

Name: Recombinant Human A Disintegrin And Metalloproteinase With Thrombospondin Motifs 4 (ADAMTS4) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-01509P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: Explore high-quality enzymes for research and supplementation, Featured enzyme molecules, High-quality recombinant proteins, Protease

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human A Disintegrin And Metalloproteinase With Thrombospondin Motifs 4 (ADAMTS4) Protein (GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	O75173
Target Symbol	ADAMTS4
Synonyms	ADAM-TS 4;ADAM-TS4;ADAMTS-4;ADMP-1;Aggrecanase-1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	FASLSRFVETLVVADDKMAAFHGAGLKRYLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILGSGEEGPQVGPSAAQTLRSFCAWQRGLNTPEDSDPDHFDTAILFTRQ
Expression Range	213-319aa
Protein Length	Partial
Mol. Weight	39.0 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Cleaves aggrecan, a cartilage proteoglycan, and may be involved in its turnover. May play an important role in the destruction of aggrecan in arthritic diseases. Could also be a critical factor in the exacerbation of neurodegeneration in Alzheimer disease. Cleaves aggrecan at the '392-Glu-\|-Ala-393' site.
Subcellular Location	Secreted, extracellular space, extracellular matrix.
Database References	HGNC: 220 OMIM: 603876 KEGG: hsa:9507 STRING: 9606.ENSP00000356975 UniGene: PMID: 29135310 ADAMTS4 was associated macrophages infiltration and polarization in the tumor microenvironment of CRC and ADAMTS4 knockdown had no inhibitory implications on cell proliferation and invasion in vitro, but significantly attenuated tumor growth in vivo. PMID: 29694979 ADAMTS4 expression was upregulated during carotid atherosclerotic plaque development. Serum levels of ADAMTS4 were associated with increased plaque vulnerability in both symptomatic and asymptomatic patients with carotid artery stenosis. PMID: 29153440 methylation status of the ADAMTS4 gene is altered in patellar tendinopathy PMID: 28888475 HipHop-based pharmacophore modeling and virtual screening of the Maybridge database to identify novel ADAMTS-4 inhibitors. These novel lead compounds act as potent and specific inhibitors for the ADAMTS-4 enzyme and could have therapeutic potential in the treatment of OA. PMID: 27401455 ADAMTS-4 protein expression increased in cartilage tissue from spinal tuberculosis patients. PMID: 28829887 Using in vitro approaches and cultured breast cancer cell lines authors demonstrate that Fibulin-2 is a better substrate for ADAMTS-5 than it is for ADAMTS-4. Fibulin-2 degradation is associated to an enhancement of the invasive potential of T47D, MCF-7 and SK-BR-3 cells. PMID: 28099917 ADAMTS4 and ADAMTS15 were upregulated in symptomatic uterine leiomyomas. PMID: 28323982 The SNP rs4233367 in the exon of ADAMTS-4 gene may be associated with lumbar disc degeneration. PMID: 26495885 Single Nucleotide Variants of Candidate Genes in Aggrecan Metabolic Pathway Are Associated with Lumbar Disc Degeneration and Modic Changes PMID: 28081267 Results show that ADAMTS4 mRNA is the target of mir-1268a and its expression might be modified by MIR-1268a rs28599926 polymorphism in hepatocellular carcinoma. PMID: 26152337 we investigated whether important polymorphisms in the ADAMTS4 and ADAMTS5 genes affect osteoarthritis (OA) susceptibility. ADAMTS4 and ADAMTS5 genotypes were determined using the ABI Prism StepOnePlus Real-Time system. Our findings suggest that the ADAMTS4 (rs4233367 and rs11807350) and ADAMTS5 (rs226794 and rs2830585) variants examined may not contribute to susceptibility to knee OA in the Turkish population. PMID: 27706574 ADAMTS4 expression is significantly upregulated in human masticatory mucosa during wound healing PMID: 28005267 ADAMTS4 may have a role in the pathogenesis by causing increased oxidative and inflammatory environment in preterm premature rupture of membranes . PMID: 27182768 in degenerative intervertebral discs, IL1b upregulates NFkB, MMP13 and ADAMTS4 PMID: 25433723 progesterone acts via the progesterone receptor to modulate ADAMTS 1 and 4 levels in ovarian cancer cell lines. PMID: 26916548 ADAMTS4 may be responsible for the pathogenesis of atherosclerosis. ADAMTS4 serum levels were also higher in diabetic cases. There is an association between ADAMTS4 and TGFb1 serum levels in the progression of atherosclerosis in coronary artery disease. PMID: 25592103 Evaluate ADAMTS-4 and ADAMTS-5 immunohistochemical expression in human TMJ discs from patients affected by internal derangement. PMID: 25477257 These data demonstrate that the antibody is specific to ADAMTS4 and ADAMTS5 and inhibits their aggrecanase activity at molecular and cellular levels. PMID: 26612259 ADAMTS4 is largely associated with synapses, and is the main brevican-processing protease. PMID: 25225099 ADAMTS-4 is a potential biomarker and an early diagnostic indicator of knee osteoarthritis. PMID: 25501175 A positive feedback loop involving sSema4D/IL-6 and TNFalpha/ADAMTS-4 may contribute to the pathogenesis of rheumatoid arthritis. PMID: 25707877 CCN1 suppresses ADAMTS-4 activity and that CCN1 overexpression is directly correlated with chondrocyte cloning in osteoarthritis cartilage. The TGFbeta/CCN1 axis plays a role in chondrocyte cluster formation through inhibition of ADAMTS-4. PMID: 25709087 Our results indicate that miR-125b plays an important role in regulating the expression of ADAMTS-4 in human chondrocytes PMID: 23406982 We conclude that the upregulation of TNF-alpha and ADAMTS-5, but not ADAMTS-4, may play an important role in degenerative cartilage endplate-induced low back pain. PMID: 24732836 The restricted expression of ADAMTS-4 and ADAMTS-5 and their increased expression in gestational trophoblastic diseases suggest that these 2 ADAMTS subtypes are associated with human placentation and the development of gestational trophoblastic diseases. PMID: 24786121 This study highlights that the affinity between a ligand and LRP1 dictates the rate of internalization and suggests that LRP1 is a major traffic controller of the two aggrecanases, especially under inflammatory conditions, where the protein levels of ADAMTS-4 increase, but those of ADAMTS-5 do not. PMID: 24474687 This is the first evidence of crosstalk between TNF-alpha and ADAMTS-4 in relation to osteoarthritis cartilage degradation. PMID: 24126638 We have demonstrated that the expression of ADAMTS-1, -4 and -5 is induced during the differentiation of monocytes into macrophages. PMID: 23859810 ADAMTS-4 and its substrate biglycan are involved in tubulogenesis by endothelial cells PMID: 24051360 ADAMTS-4_v1 is expressed as a protein in vivo in human osteoarthritis synovium, functions as an aggrecanase, and cleaves other proteoglycan substrates. PMID: 23897278 Cartilage affected by varying degrees of osteoarthritis stained strongly for active ADAMTS-4 where surface fibrillation and clustered chondrocytes were observed. PMID: 23295731 The purpose of the present study was to investigate the precise molecular mechanisms of high molecular weight hyaluronic acid on ADAMTS4 expression induced by IL- 1b in vitro. PMID: 23438438 Sp1 transcription factor partly mediates IL-1 induction of ADAMTS-4. PMID: 22065068 AMTS4 has roles in melanoma growth and angiogenesis PMID: 23319426 Citrullinated fibronectin is less effective in inhibiting the proteolytic activity of ADAMTS4 and may contribute to the destruction of joint cartilage in rheumatoid arthritis. PMID: 23137648 The serine protease tissue plasminogen activator (tPA) and two matrix metalloproteinases, ADAMTS-4 and ADAMTS-5, were identified as Reelin cleaving enzymes. PMID: 23082219 study showed that ADAMTS-1, -4, -5 and TIMP3 were expressed at differential levels in hepatocellular carcinoma cell lines PMID: 22735305 Data suggest that cleavage of aggrecan by matrix metalloproteinases in knee cartilage from injured or osteoarthritic subjects is low compared with cleavage by aggrecanase-1 (at least early in osteoarthritis, as suggested by other evidence). PMID: 22670872 results suggest that during the acute phase after knee injury there is an increased aggrecanase activity against both the interglobular domain (IGD) and the CS2 cleavage sites of joint cartilage aggrecan PMID: 21664283 Data show that the expression of ADAMTS4, 9, 16 and was up-regulated during chondrogenesis, ADAMTS1 and 5 were down-regulated. PMID: 22562232 Suggest IL-6 may participate in cartilage destruction in rheumatoid arthritis as an inducer of ADAMTS-4 expression from synoviocytes. PMID: 22324945 Multiple matrix metalloproteinases and ADAMTS-4 are involved in the natural history of interverteral lumbar disc herniation. PMID: 20857147 Serum ADAMTS4 levels are associated with the presence and the severity of coronary artery disease. PMID: 21946608 ADAMTS-4 is present in human coronary atherosclerotic plaques. PMID: 21345877 effect of transforming growth factor-beta (TGF-beta) on ADAMTS-4 expression in macrophages along with the regulatory mechanisms underlying its actions PMID: 21334453 Patients with acute coronary syndrome showed increased ADAMTS4 expression, which may aggravate the development of atherosclerosis and instability of atherosclerotic plaques. PMID: 20625753 ADAMTS4 expression was found to be regulated by EWS-FLI1 fusion gene-dependent manner. ADAMTS4 protein was highly expressed in tumor samples of the patients with EWS by using immunohistochemistry. PMID: 20664926 Plasma ADAMTS4 was measured in stable-effort angina pectoris, acute coronary syndrome & controls. The pattern of its release was clearly different in various forms of ACS. It showed a weak correlation with high-sensitivity C-reactive protein. PMID: 19944557 The C-terminal domains of ADAMTS-4 and ADAMTS-5 affect the structure around the active site, favouring interaction with TIMP-3. PMID: 19643179

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.