Recombinant Human A Disintegrin And Metalloproteinase With Thrombospondin Motifs 2 (ADAMTS2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-11286P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human A Disintegrin And Metalloproteinase With Thrombospondin Motifs 2 (ADAMTS2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-11286P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human A Disintegrin And Metalloproteinase With Thrombospondin Motifs 2 (ADAMTS2) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | O95450 |
| Target Symbol | ADAMTS2 |
| Synonyms | A disintegrin and metalloproteinase with thrombospondin motifs 2; A disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif 2; ADAM metallopeptidase with thrombospondin type 1 motif 2; ADAM TS 2; ADAM TS2; ADAM-TS 2; ADAM-TS2; ADAMTS 3; ADAMTS-2; ADAMTS2; ATS2_HUMAN; EC 3.4.24.14; EDS VIIB; EDS VIIC; hPCPNI ; NPI ; PC I NP; PC I-NP; PCINP ; PCPNI ; pNPI; Procollagen I N proteinase; Procollagen I N-proteinase; Procollagen I/II amino propeptide processing enzyme; Procollagen I/II amino propeptide-processing enzyme; Procollagen N endopeptidase ; Procollagen N-endopeptidase |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | RRRARRHAADDDYNIEVLLGVDDSVVQFHGKEHVQKYLLTLMNIVNEIYHDESLGAHINVVLVRIILLSYGKSMSLIEIGNPSQSLENVCRWAYLQQKPDTGHDEYHDHAIFLTRQDFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDEVRLGSIMAPLVQAAFHRFHWSRCSQQELSRYLHSYDCLLDDPFAHDWPALPQLPGLHYSMNEQC |
| Expression Range | 254-492aa |
| Protein Length | Partial |
| Mol. Weight | 32.2 kDa |
| Research Area | Cancer |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Cleaves the propeptides of type I and II collagen prior to fibril assembly. Does not act on type III collagen. Cleaves lysyl oxidase LOX at a site downstream of its propeptide cleavage site to produce a short LOX form with reduced collagen-binding activity. |
| Subcellular Location | Secreted, extracellular space, extracellular matrix. |
| Database References | HGNC: 218 OMIM: 225410 KEGG: hsa:9509 STRING: 9606.ENSP00000251582 UniGene: PMID: 26765342 |
