Recombinant Human 67kDa Laminin Receptor / 67LR Protein

Name: Recombinant Human 67kDa Laminin Receptor / 67LR Protein
Brand: Beta LifeScience
SKU: BLA-2491P
Availability: InStock

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P08865
Synonym	34/67 kDa laminin receptor 37 kDa laminin receptor precursor 37/67 kDa laminin receptor 37LRP 40S ribosomal protein SA 67 kDa laminin receptor 67LR Colon carcinoma laminin binding protein Colon carcinoma laminin-binding protein LAMBR Laminin receptor 1 Laminin-binding protein precursor p40 LamR LAMR 1 LAMR1 LBP LBP/p40 LRP LRP/LR Multidrug resistance associated protein MGr1 Ag Multidrug resistance associated protein MGr1Ag Multidrug resistance-associated protein MGr1-Ag NEM/1CHD4 p40 Ribosomal Protein SA rpsA RSSA_HUMAN SA
Description	Recombinant Human 67kDa Laminin Receptor / 67LR Protein was expressed in Wheat germ. It is a Full length protein
Source	Wheat germ
AA Sequence	MSGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIIN LKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIA GRFTPGTFTNQIQAAFREPRLLVVTDPRAGHQPLTEASYVNLPTIALCNT DSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPD LYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSE GVQVPSVPIQQFPTEDWSAQPATEDWSAAPTAQATEWVGATTDWS
Molecular Weight	59 kDa including tags
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. Plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. May play a role in cell fate determination and tissue morphogenesis. Acts as a PPP1R16B-dependent substrate of PPP1CA.; (Microbial infection) Acts as a receptor for the Adeno-associated viruses 2,3,8 and 9.; (Microbial infection) Acts as a receptor for the Dengue virus.; (Microbial infection) Acts as a receptor for the Sindbis virus.; (Microbial infection) Acts as a receptor for the Venezuelan equine encephalitis virus.; (Microbial infection) Acts as a receptor for the pathogenic prion protein.; (Microbial infection) Acts as a receptor for bacteria.
Subcellular Location	Cell membrane. Cytoplasm. Nucleus.
Protein Families	Universal ribosomal protein uS2 family
Database References	HGNC: 6502 OMIM: 150370 KEGG: hsa:3921 STRING: 9606.ENSP00000346067 UniGene: PMID: 30072435 The binding of laminin-1 to 67LR causes initial signaling through PKA and Epac, which causes the internalization of 67LR, along with signaling enzymes, such as adenylyl cyclase, into early endosomes. This causes sustained signaling for protection against neuronal cell death induced by serum withdrawal. PMID: 29108990 We suggest that PrP(C) and its interactor, LR/37/67 kDa, could be potential therapeutic targets for schwannomas and other Merlin-deficient tumours. PMID: 28692055 Our results suggest that hypoxia-elicited c-Jun/activator protein 1 regulates 37-kDa laminin receptor precursor expression, which modulates migration and invasion of lung adenocarcinoma cells PMID: 28618937 Increased LRP levels correlate with the increased invasive and adhesive potential in early and late stage melanoma cells. PMID: 28118986 A polysaccharide from Pinellia ternata inhibits cell proliferation and metastasis in human cholangiocarcinoma cells by targeting of Cdc42 and 67kDa Laminin Receptor PMID: 27576948 67LR plays a considerable role in the development of colon cancer multidrug resistance PMID: 26293895 37LRP regulates the metastasis of glioma cells in vitro and tumor growth in vivo. PMID: 27748570 Higher molecular weight Rpsa requires sumoylation to form. PMID: 26146125 Knock-Down of the 37kDa/67kDa Laminin Receptor LRP/LR Impedes Telomerase Activity PMID: 26545108 High expression level of the laminin receptor is associated with Breast and Oesophageal Cancer. PMID: 26427016 Report discovery of new small molecules inhibiting 67 kDa laminin receptor interaction with laminin and cancer cell invasivness. PMID: 26062445 LR1 contributes to hypoxia-induced migration and invasion of trophoblast cells at least partly by mediating MMP-9 PMID: 25800042 Mutations in the gene RPSA, which encodes ribosomal protein SA, cause more than half of the cases of isolated congenital asplenia. These disease-causing mutations lead to haploinsufficiency of RPSA. Review. PMID: 25840456 analysis of the complex three-way interaction between the non-integrin laminin receptor, galectin-3 and Neisseria meningitidis PMID: 25274119 Studies indicate that the expression of 37/67-kDa immature laminin receptor protein (iLRP)iLRP in the rodent and human fetus is phase specific PMID: 25082063 Suggest role for 67LR/mitogen activated protein kinase/DUSP pathway in influencing glioma cell proliferation. PMID: 25778325 a biological marker in distinguishing squamous cell carcinoma: from adenocarcinoma, neuroendocrine carcinomas, and malignant mesothelioma PMID: 24805133 LRP/LR is a receptor for amyloid-beta42 internalization, mediating its endocytosis and contributing to the cytotoxicity of the neuropeptide. PMID: 24990253 Data suggest thet 67-kDa laminin receptor-dependent protein phosphatase 2A (67LR/PP2A) may be a promising therapeutic target for melanomas. PMID: 25294877 Results indicate that MGr1-Ag/37LRP contributes to laminin-mediated cell adhesion-mediated drug resistance in gastric cancer cells. PMID: 24840404 Mutants in the RPSA gene might be associated with genetic susceptibility to colorectal cancer. PMID: 24460263 LamR interaction with the yeast prion-forming protein, Sup35, was investigated. PMID: 24416454 as a receptor of ECM components, MGr1-Ag/37LRP may activate the downstream signal pathway PI3K/AKT and MAPK/ERK through interaction with phosphorylated FAK. PMID: 24703465 RNA interference-mediated silencing of laminin receptor 1 (LR1) suppresses migration and invasion and down-regulates matrix metalloproteinase (MMP)-2 and MMP-9 in trophoblast cells. PMID: 23729238 findings indicate that 37/67LR regulates proliferation and adhesion in normal intestinal epithelial cells independently of its known association with ribosomal function PMID: 23991217 PEDF causes anti-angiogenic, anti-inflammatory and anti-thrombogenic reactions in myeloma cells through the interaction with LR. PMID: 24342618 LRP/LR is involved in the maintenance of cellular viability in tumorigenic lung and cervix uteri cells through the blockage of apoptosis PMID: 23472084 MGr1-Ag promotes small-cell lung cancer cell invasion and bone metastasis in vitro and in vivo, and that this is partially mediated via the epithelial-mesenchymal transition pathway. PMID: 23588894 This discovery establishes an essential role for RPSA in human spleen development. PMID: 23579497 67LR functions as a cancer-specific death receptor. In this cell death receptor pathway, cGMP initiated cancer-specific cell death by activating the PKCdelta/acid sphingomyelinase (PKCdelta/ASM) pathway. PMID: 23348740 Identification of novel laminin receptor binding proteins from whole cell extracts. PMID: 22909348 The 67 kD laminin receptor is a novel PED/PEA-15 interacting protein. PED/PEA-15 overexpression increases 67LR-mediated cell adhesion and migration to laminin and extracellular matrix invasion. PMID: 21895963 results suggest that RNF8 and BRCA1 are anchored to the nucleolus through reversible interactions with RPSA PMID: 22814251 the nature of the EGCG-67LR interaction and novel structural insights into the understanding of 67LR-mediated functions of EGCG PMID: 22666419 a high plasticity of RPSA, which could be important for its multiple cellular localizations and functional interactions PMID: 22640394 key structural determinants of the interaction of LamR with laminin-1 PMID: 22290616 Data indicate that high iLR expression was strongly correlated with negativity for CD38 and ZAP-70 expression and mutated IGVH gene status. PMID: 21055809 Decreased LR1 expression in cytotrophoblasts and syncytiotrophoblasts of preeclamptic placentas, which may be independent of disease severity, might have a role in shallow trophoblastic invasion in preeclampsia. PMID: 21391874 The genotypes and allele frequencies of the RPSA polymorphisms showed no significant differences between the controls and sporadic CJD patients. PMID: 21838916 The ability of LAMR to regulate viability is associated with its C-terminal 75 residues. PMID: 21243100 the SA C-terminal domain in the spatial structure of the 40S subunit PMID: 21167900 67-kDa laminin receptor expression influenced the characteristics of leukemia cells toward an aggressive phenotype and increased the number of granulocyte-macrophage colony-stimulating factor receptors PMID: 21056082 Here, the authors identify a laminin binding site on LamR, comprising residues Phe32, Glu35, and Arg155, which are conserved among mammalian species. PMID: 21040730 67LR induces FasL expression and cytotoxicity against Fas-sensitive Jurkat T cells in human cholangiocarcinoma cells through the phosphorylation of c-Myc on Ser-62 and the subsequent activation of the FasL promoter through the ERK pathway PMID: 20101459 Studies indicate that the 37-kDa/67 kDa laminin receptor is a receptor for the cellular prion protein (PrPc). PMID: 20515747 67LR promotes the invasive and metastatic ability of the gastric cancer cells through increasing urokinase and MMP 9 expression. PMID: 20491781 TSAd associates with laminin binding protein and mediates T lymphocyte migration during T cell activation PMID: 19561400 Results suggested that the LBP receptor domain interacting with venezuelan equine encephalitis E2 and tick-borne encephalitis virus E viral proteins is located at the C-terminal fragment of the LBP molecule. PMID: 19961413 Tthese results show that 37LRP has some of the biological activities of 67LR, even prior to the conversion event. However, the conversion affects the sites of interaction with both laminin and heparan sulfate. PMID: 19691449

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human 67kDa Laminin Receptor / 67LR Protein

Recombinant Human 67kDa Laminin Receptor / 67LR Protein

Product Overview

Target Details

FAQs