Recombinant Human 67kDa Laminin Receptor / 67LR Protein
Beta LifeScience
SKU/CAT #: BLA-2491P
Recombinant Human 67kDa Laminin Receptor / 67LR Protein
Beta LifeScience
SKU/CAT #: BLA-2491P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Host Species | Human |
| Accession | P08865 |
| Synonym | 34/67 kDa laminin receptor 37 kDa laminin receptor precursor 37/67 kDa laminin receptor 37LRP 40S ribosomal protein SA 67 kDa laminin receptor 67LR Colon carcinoma laminin binding protein Colon carcinoma laminin-binding protein LAMBR Laminin receptor 1 Laminin-binding protein precursor p40 LamR LAMR 1 LAMR1 LBP LBP/p40 LRP LRP/LR Multidrug resistance associated protein MGr1 Ag Multidrug resistance associated protein MGr1Ag Multidrug resistance-associated protein MGr1-Ag NEM/1CHD4 p40 Ribosomal Protein SA rpsA RSSA_HUMAN SA |
| Description | Recombinant Human 67kDa Laminin Receptor / 67LR Protein was expressed in Wheat germ. It is a Full length protein |
| Source | Wheat germ |
| AA Sequence | MSGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIIN LKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIA GRFTPGTFTNQIQAAFREPRLLVVTDPRAGHQPLTEASYVNLPTIALCNT DSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPD LYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSE GVQVPSVPIQQFPTEDWSAQPATEDWSAAPTAQATEWVGATTDWS |
| Molecular Weight | 59 kDa including tags |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Liquid Solution |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |
Target Details
| Target Function | Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. Plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. May play a role in cell fate determination and tissue morphogenesis. Acts as a PPP1R16B-dependent substrate of PPP1CA.; (Microbial infection) Acts as a receptor for the Adeno-associated viruses 2,3,8 and 9.; (Microbial infection) Acts as a receptor for the Dengue virus.; (Microbial infection) Acts as a receptor for the Sindbis virus.; (Microbial infection) Acts as a receptor for the Venezuelan equine encephalitis virus.; (Microbial infection) Acts as a receptor for the pathogenic prion protein.; (Microbial infection) Acts as a receptor for bacteria. |
| Subcellular Location | Cell membrane. Cytoplasm. Nucleus. |
| Protein Families | Universal ribosomal protein uS2 family |
| Database References | HGNC: 6502 OMIM: 150370 KEGG: hsa:3921 STRING: 9606.ENSP00000346067 UniGene: PMID: 30072435 |
