Recombinant Human 5-Hydroxytryptamine Receptor 1D (HTR1D) Protein (hFc)
Beta LifeScience
SKU/CAT #: BLC-07699P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human 5-Hydroxytryptamine Receptor 1D (HTR1D) Protein (hFc)
Beta LifeScience
SKU/CAT #: BLC-07699P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human 5-Hydroxytryptamine Receptor 1D (HTR1D) Protein (hFc) is produced by our Yeast expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P28221 |
| Target Symbol | HTR1D |
| Synonyms | HTR1D; HTR1DA; HTRL; 5-hydroxytryptamine receptor 1D; 5-HT-1D; 5-HT1D; Serotonin 1D alpha receptor; 5-HT-1D-alpha; Serotonin receptor 1D |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | C-hFc |
| Target Protein Sequence | MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALK |
| Expression Range | 1-38aa |
| Protein Length | Partial |
| Mol. Weight | 32.3 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for ergot alkaloid derivatives, various anxiolytic and antidepressant drugs and other psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Regulates the release of 5-hydroxytryptamine in the brain, and thereby affects neural activity. May also play a role in regulating the release of other neurotransmitters. May play a role in vasoconstriction. |
| Subcellular Location | Cell membrane; Multi-pass membrane protein. |
| Protein Families | G-protein coupled receptor 1 family |
| Database References | HGNC: 5289 OMIM: 182133 KEGG: hsa:3352 STRING: 9606.ENSP00000313661 UniGene: PMID: 26214021 |
