Recombinant Human 40S Ribosomal Protein S6 (RPS6) Protein (His-GST)

Name: Recombinant Human 40S Ribosomal Protein S6 (RPS6) Protein (His-GST)
Brand: Beta LifeScience
SKU: BLC-06137P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human 40S Ribosomal Protein S6 (RPS6) Protein (His-GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P62753
Target Symbol	RPS6
Synonyms	40S ribosomal protein S6; Air8; NP33; Phosphoprotein NP33; Pp30; Ribosomal protein S6; RP S6; rps6; RS6; RS6_HUMAN; S6; S6 Ribosomal Protein
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-GST
Target Protein Sequence	EVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVPRRLGPKRASRIRKLFNLSKEDDVRQYVVRKPLNKEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQRTKKNKEEAAEYAKLLAKRMKEAKEKRQEQIA
Expression Range	35-229aa
Protein Length	Partial
Mol. Weight	53.9 kDa
Research Area	Epigenetics And Nuclear Signaling
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Component of the 40S small ribosomal subunit. Plays an important role in controlling cell growth and proliferation through the selective translation of particular classes of mRNA.
Protein Families	Eukaryotic ribosomal protein eS6 family
Database References	HGNC: 10429 OMIM: 180460 KEGG: hsa:6194 STRING: 9606.ENSP00000369757 UniGene: PMID: 29563586 single 60-min bout of peristaltic pulse external pneumatic compression transiently upregulates phosphorylated ribosomal protein s6 and the Akt-mTOR signalling cascade. PMID: 26769680 MiR-129-5p sensitized Her-2-positive breast cancer to trastuzumab by downregulating rpS6. PMID: 29258115 Dual PI3K/mTOR inhibition represents an effective therapeutic strategy in uterine leiomyosarcoma, and p-S6(S240) expression is a potential predictive biomarker for response to treatment. PMID: 28232476 this study unveils an unprecedented correlation of mTOR activation with improved clinical outcome in patients with laryngeal carcinomas and uncovers the potential of p-S6 expression as a good prognostic biomarker and an inverse predictor of lymph node and distant metastases. PMID: 27119232 the aggregation of rpS6 at the nucleolus correlates to the phasing of cell cycle, beginning to concentrate in the nucleolus at later S phase and disaggregate at M phase. PMID: 26639987 Study examined baseline levels of S6 phosphorylated at Ser235/236 (pS6Ser235/236) or Ser240/244 (pS6Ser240/244)and a possible effect of tau pathology. Findings argue against the idea that high levels of pS6Ser235/236 in neurons are a consequence of a higher expression of S6 protein and speak for an increased phosphorylation of S6 in intensely pS6Ser235/236-labeled neurons. PMID: 28119058 Data suggest ribosomal protein S6 (rpS6) as tumor marker for renal cell carcinoma. PMID: 26506236 Hyperphosphorylation of ribosomal protein S6 predicts unfavorable clinical survival in non-small cell lung cancer PMID: 26490682 p-rpS6 is a robust post-treatment indicator of HER2 pathway-targeted therapy resistance PMID: 26329528 Resistance to Selumetinib (AZD6244) in colorectal cancer cell lines is mediated by p70S6K and RPS6 activation. PMID: 25379021 Tanshinone IIA inhibits HIF-1alpha and VEGF expression in breast cancer cells via mTOR/p70S6K/RPS6/4E-BP1 signaling pathway. PMID: 25659153 The expression levels of phospho-mTOR and phospho-S6RP may be potential predictive biomarkers for efficacy of everolimus in patients with metastatic renal cell carcinoma. PMID: 24886512 we report that phosphorylation of ribosomal protein S6 is greatly increased in BRCA1 deficient cells resistant to PARP inhibition PMID: 24831086 Suggest phosphorylated S6 as an immunohistochemical biomarker of vulvar intraepithelial neoplasia. PMID: 23765247 Suggest that p-S6 and the ratio of p-S6/S6 are closely relevant to tumor progression and have prognostic significance in esophageal squamous cell carcinoma. PMID: 22996377 S6 phosphorylation at S240/4 is strongly cell cycle-regulated. PMID: 23255058 High Ribosomal Protein S6 is associated with renal cell carcinoma metastases. PMID: 21792700 a novel mechanism for modulating the RPS6 function by PP1 and ATM which regulates cell growth and survival in response to DNA-damage stim PMID: 22451389 Nearly 20-fold more neurons contain pS6-positive granules in Alzheimer's disease hippocampus compared to age-matched controls. PMID: 21968813 Downregulation of HELZ reduced translational initiation, resulting in the disassembly of polysomes, in a reduction of cell proliferation and hypophosphorylation of ribosomal protein S6. PMID: 21765940 Here, the authors show that ribosomal protein S6 (RPS6) interacts with LANA. PMID: 21734034 The mTOR/S6 signal pathway is activated in refractory/relapsed aplastic anemia, and can be suppressed by rapamycin or CTLA-4Ig. PMID: 19954658 RPS6 associates with multiple mRNAs containing a 5' terminal oligopyrimidine tract. These findings expand our understanding of the mechanism(s) involved in ribosomal biogenesis and deregulated protein synthesis in diffuse large B-cell lymphoma (DLBCL). PMID: 21102526 S240/244-phosphorylated S6 is predominantly nuclear but detectable in the cytoplasm, whereas S235/236-phosphorylated S6 is exclusively localized to the nucleus. PMID: 20625781 Regulation of ribosomal protein S6 phosphorylation by casein kinase 1 and protein phosphatase 1. PMID: 21233202 Increased lipogenesis, induced by AKT-mTORC1-RPS6 signaling, promotes development of human hepatocellular carcinoma. PMID: 21147110 Data show that the mTOR effectors, 4EBP1, p70S6K and rpS6, are highly activated in cultured and primary FLT3-mutated acute myeloid leukemia (AML) cells. PMID: 21067588 when exercise is performed in a fasted state, the increase in phosphorylation of signalling molecules such as p70(S6k) and the S6 ribosomal protein in human muscle depends on the exercise volume PMID: 20617335 Genetic alterations of TP53 and RPS6 were different in different areas of the same oral squamous cell carcinoma tumor. PMID: 17565818 Rheb is a mediator of RPS6. PMID: 12820960 IFNgamma-activated p70 S6 kinase phosphorylates the 40S S6 ribosomal protein on serines 235/236, to regulate IFNgamma-dependent mRNA translation. PMID: 15051500 Cortical tuber giant cells in a case of epileptogenic tuberous sclerosis showed predominantly nuclear hamartin, cytosolic tuberin, and hyperphosphorylation of S6. PMID: 15477556 the phosphorylation of Tyr(1077) on LepRb during receptor activation, substantiate the hypothalamic regulation of STAT5 and S6 by leptin, and define the alternate LepRb signaling pathways PMID: 17726024 Structure, localization and molecular assembly in vitro and in vivo of a human rpS6, were examined using antibodies (Abs) prepared by immunizing rabbits with synthetic peptides. PMID: 18039684 The level of phosphorylated S6 ribosomal protein expression was predictive of early tumor response to the mammalian target of rapamycin (mTOR)inhibitor, suggesting that this is a promising new predictive sarcoma marker for targeted mTOR inhibitor therapy PMID: 18157089 The results demonstrate that multiple muscarinic receptor subtypes regulate mTOR, and that both MAPK-dependent and -independent mechanisms may mediate the response in a cell context-specific manner. PMID: 18348264 rpS6, especially in its unphosphorylated form, is a selective mediator of TRAIL-induced apoptosis PMID: 18362888 Resistance exercise decreases eIF2Bepsilon phosphorylation and potentiates the feeding-induced stimulation of p70S6K1 and rpS6 in young men. PMID: 18565837 Basophilic inclusions from patients with adult-onset atypical motor neuron disease were distinctly labeled with the antibodies against poly(A)-binding protein 1, T cell intracellular antigen 1, and ribosomal protein S6. PMID: 18642007

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.