Recombinant Human 40S Ribosomal Protein S27 (RPS27) Protein (GST)

Name: Recombinant Human 40S Ribosomal Protein S27 (RPS27) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-09269P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human 40S Ribosomal Protein S27 (RPS27) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P42677
Target Symbol	RPS27
Synonyms	2610206D02Rik; 3200001M24Rik; 40S ribosomal protein S27; C530005D02Rik; Metallopan stimulin 1; Metallopan-stimulin 1; Metallopanstimulin 1; Metallopanstimulin1; MPS 1; MPS-1; MPS1; pmn; Ribosomal protein S27; Ribosomal protein S27 metallopanstimulin 1; rps27; RS27_HUMAN; S27; snoRNA MBI 112
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH
Expression Range	1-84aa
Protein Length	Full Length
Mol. Weight	36.3kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Component of the small ribosomal subunit. Required for proper rRNA processing and maturation of 18S rRNAs.
Protein Families	Eukaryotic ribosomal protein eS27 family
Database References	HGNC: 10416 OMIM: 603702 KEGG: hsa:6232 STRING: 9606.ENSP00000357555 UniGene: Hs.546291
Associated Diseases	Diamond-Blackfan anemia 17 (DBA17)
Tissue Specificity	Expressed in a wide variety of actively proliferating cells and tumor tissues.

Gene Functions References

Chloride anion behaves as a signaling effector for CFTR in the modulation of RPS27 expression. PMID: 28941802
reveal how Mps1 dynamically modifies kinetochores to correct improper attachments and ensure faithful chromosome segregation PMID: 28441529
MPS1 is a new marker of Purkinje Cells. PMID: 26708598
We identified frequent recurrent (i.e. hotspot) mutation in the 5' untranslated region of RPS27 in ~10% of melanoma samples PMID: 24913145
The data on genome context analysis indicates that the presence of MPS-1 in the blood is an indicator of oncogenesis PMID: 22798506
This work is consistent with a critical role of RPMPS-1/S27 in the life cycle of various viruses and shows that disruption of viral ZFPs is potentially important to control and prevent deathly viral diseases PMID: 21518817
study reveals a multilevel interplay between RPS27L/S27 and p53-MDM2 axis, with RPS27L functioning as a p53 target, a MDM2 substrate and a p53 regulator PMID: 21170087
When MPS-1 is overexpressed, it has an extraribosomal function as a strong inhibitor of HNSCC tumor cell growth, which may be exerted by reduced paxillin gene expression. PMID: 19642098
MPS-1 was overexpressed in 86% of the gastric cancer tissues and all gastric cancer cells. MPS-1 expression was significantly increased and corresponded with the tumor-node-metastasis clinical stage, and was significantly higher in the late stage. PMID: 16914586

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.