Recombinant Human 3-Oxo-5-Alpha-Steroid 4-Dehydrogenase 1 (SRD5A1) Protein (His)

Name: Recombinant Human 3-Oxo-5-Alpha-Steroid 4-Dehydrogenase 1 (SRD5A1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-07920P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human 3-Oxo-5-Alpha-Steroid 4-Dehydrogenase 1 (SRD5A1) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Activity	Not tested.
Uniprotkb	P18405
Target Symbol	SRD5A1
Synonyms	SR type 1;Steroid 5-alpha-reductase 1;S5AR 1
Species	Homo sapiens (Human)
Expression System	in vitro E.coli expression system
Tag	N-10His
Target Protein Sequence	MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF
Expression Range	1-259aa
Protein Length	Full Length
Mol. Weight	32.3 kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.
Subcellular Location	Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families	Steroid 5-alpha reductase family
Database References	HGNC: 11284 OMIM: 184753 KEGG: hsa:6715 STRING: 9606.ENSP00000274192 UniGene: PMID: 29084161 Findings suggest that 5alpha-reductases (5-AR) isoenzymes could be explored as a therapeutic target for urothelial bladder cancer (UBC) with 5alpha-reductase inhibitors (5-ARI). PMID: 29187470 we demonstrated that AR, 5alphaR1 and 5alphaR2 immunoreactivity in bladder urothelial carcinoma cells significantly decreased with advanced tumor grade. PMID: 28947209 Studies indicate that enhanced 5alpha-reductase activity in subjects with polycystic ovary syndrome (PCOS) was associated with insulin resistance (IR) rather than obesity. PMID: 28347315 Although 4-dione is the main source of 5alpha-dihydrotestosterone in human preadipocytes, production of this steroid by 5 alpha-reductase isoenzymes (SRD5A1, 2 and 3) mediates the inhibitory effect of both 4-dione and testosterone on preadipocyte differentiation. PMID: 26855069 SRD5A1 small-interfering RNA knockdown led to significant increase in progesterone receptor-B nuclear import, ectopic, whereas SRD5A1 overexpression resulted in remarkable inhibition of nuclear progesterone receptor-B in P4-treated cells. Repression of SRD5A1 activated progesterone receptor-B responsive gene, whereas overexpression of SRD5A1 possessed an inhibitory effect. PMID: 26243543 the genotypic distribution of 22 single nucleotide polymorphisms in SRD5A1 and SRD5A2 in a set of Spanish prostate cancer patients, were evaluated. PMID: 26174685 A total of 2 SNPs in SRD5A1-rs3822430 and rs1691053-were associated with prostate-specific antigen level at diagnosis. PMID: 25960412 study found SRD5A enzyme is present in spermatozoa and that its cellular content is lowered in sperm samples from varicocele patients compared to healthy subjects PMID: 25850410 Results show that 5alpha-reductase type 1 was associated with intratumoral dihydrotestosterone concentrations and is an independent prognostic factor in endometrioid endometrial adenocarcinoma. PMID: 25475427 In model cell lines of endometrial cancer, AKR1C2 and SRD5A1 have crucial roles in progesterone metabolism. PMID: 25463305 Increased 5alphaR activity and glucocorticoid secretion rate over time are linked with the development of metabolic disease, and may represent targets for therapeutic intervention. PMID: 24986533 SRD5A1 rs166050C risk variant was associated with greater prostatic exposure to androsterone PMID: 24277450 Significantly higher levels of SRD5A1, AKR1C2, AKR1C3, and HSD17B10 mRNA were however found in bone metastases than in non-malignant and/or malignant prostate tissue PMID: 24244276 SRD5A1 and SRD5A2 single nucleotide polymorphisms are significantly associated with the clinical characteristics of benign prostatic hyperplasia and the efficacy of benign prostatic hyperplasia treatment. PMID: 23499746 Different effects were seen for progesterone, which significantly decreased SRD5A1 protein levels. PMID: 23183084 Postmenopausal breast cancer risk associated with combined therapy may be modified by genetic variation in SRD5A1 PMID: 21947678 Based on a limited selection of gene variants, no involvement of SRD5A1, SRD5A2, ESR1, ESR2 or PGR in female pattern hair loss is evident. PMID: 22509838 The different expression levels of 5alpha-reductase isoenzymes may confer response or resistance to 5alpha-reductase inhibitors. PMID: 22194926 Ten percent of cases and 44% of controls had the cytosine/cytosine (C/C) genotype for the SRD5A1 SNP, rs501999 indicating that this genotype may protect women against severe premenstrual symptoms. PMID: 22273344 Evidence of association of two alleles for alcohol dependence (AD) is found in SRD5A1 and AKR1C3, mediating a protective effect of the minor allele at each AD marker based on the genotype of the second marker. PMID: 21323680 Show positive associations of several SRD5A1 and SRD5A2 variations as independent predictors of biochemical recurrence after radical prostatectomy. PMID: 21715084 Single nucleotide polymorphisms in the two isoforms of 5alpha-reductase, SRD5A1 and SRD5A2, are associated with lean patients with polycystic ovary syndrome. PMID: 21530059 the dominant route of Dihydrotestosterone synthesis in castration-resistant prostate cancer bypasses testosterone, and instead requires 5alpha-reduction of androstenedione by SRD5A1 to 5alpha-androstanedione, which is then converted to DHT PMID: 21795608 A statistically significant reduction of SRD5A1, SRD5A2, and CYP19A gene expression was found in the dermal papillae cells and peripheral blood mononuclear cells in idiopathic hirsutism. PMID: 21676395 Pitfalls in the diagnosis of 5alpha-reductase type 2 deficiency during early infancy. PMID: 21447938 High nuclear SRD5A1 expression is associated with higher prostate cancer stage. PMID: 20519274 We investigated associations between single nucleotide polymorphisms in genes HSD3B1, SRD5A1/2, and AKR1C2 and prostate cancer risk PMID: 20056642 Data indicate that enzymes CYP17A1 and HSD3B1 showed low expression, while AKR1C3 and SRD5A1 were abundantly expressed. PMID: 20086173 role in blood pressure PMID: 11903314 examination of differential methylation of isoenzyme genes in lymphocytes PMID: 11948017 polymorphisms of SRD5A1 and SRD5A2 genes may not be directly associated with the development of baldness or generation of different clinical phenotypes. PMID: 12670724 Loss of 5alpha-reductase type I expression is associated with metastatic prostate cancer PMID: 12738739 Changes in 5alpha-reductase, 11beta-HSD1, and 20alpha/beta-HSD enzyme activities observed in polycystic ovary syndrome may contribute to increased production of cortisol and androgens. PMID: 14671189 Mutant SRD5A1 isoenzyme does not seem to play a crucial role in the development of hypospadias. PMID: 14739525 The direct challenge of beta-adrenergic agonists to glioma cells resulted in the rapid and transient elevation of 5alpha-R mRNA levels through the activation of the cyclic AMP (cAMP)/protein kinase A-mediated signaling pathway. PMID: 14997014 Glucocorticoids and androgens differentially regulate 5alphaR1 mRNA in the rat liver. Regulation of 5alphaR1 gene is primarily at the post-transcriptional level. PMID: 15004407 Candidate gene for benign prostatic hyperplasia. PMID: 15136785 Expression of SRD5A1 (5alphaR1) and SRD5A2 (5alphaR2) is elevated, and expression of AKR1C1 (20alpha-HSO), AKR1C2 (3alpha-HSO3) and AKR1C3 (3alpha-HSO2) is reduced in tumorous as compared to normal breast tissue. PMID: 15212687 5alpha-reductase type 1 (5alphaR1) immunostaining is increased and 5alpha-reductase type 2(5alphaR2) immunostaining is decreased during development of prostate cancer and there is increased expression of both in recurrent and metastatic cancers PMID: 15538746 Serenoa repens inhibits this enzyme in the prostate, but does not suppress prostate-specific antigen secretion in prostate cancer. PMID: 15543614 5alpha-reductase is expresed in human embryonic kidney cell line HEK293 PMID: 15792368 The expression of 5alpha-reductase type I mRNA was not regulated by calcitriol in a prostate tumor cell line. PMID: 15862960 SRD5A1 is abundantly transcribed in normal human genital skin fibroblasts and may play an important role in masculinization of SRD5A2-deficient males. PMID: 15941927 The SRD5A1 mRNA expression is 2-fold lower than SRD5A2 in normal rat. PMID: 16818707 These results suggest that intratumoral 5 alpha-dihydrotestosterone concentration is mainly determined by 5alphaRed1 and aromatase in breast carcinoma tissues. PMID: 17066438 Both 5-alpha-reductase I and II are expressed in normal human prostate stromal and epithelial cells. Only 5-alpha-reductase isoenzymes of prostate epithelium are modulated by oxytocin. PMID: 18008328 Hepatocyte growth factor stimulates 5alpha-R1 expression through up-regulation of the transcription factor early growth response 1 PMID: 18215136 Our results demonstrate that the 5alphaR activities of either bDPCs or sDPCs are stronger than that of dermal fibroblasts, despite the fact that the major steroidogenic activity is attributed to 17beta-HSD rather than 5alphaR among the three cell types. PMID: 18258185 Testosterone 5-alpha-Reductase deficiency is associated with gender identity PMID: 18422030

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.