Recombinant Human 3-Hydroxy-3-Methylglutaryl-Coenzyme A Reductase (HMGCR) Protein (His)

Name: Recombinant Human 3-Hydroxy-3-Methylglutaryl-Coenzyme A Reductase (HMGCR) Protein (His)
Brand: Beta LifeScience
SKU: BLC-03177P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human 3-Hydroxy-3-Methylglutaryl-Coenzyme A Reductase (HMGCR) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P04035
Target Symbol	HMGCR
Synonyms	3 hydroxy 3 methylglutaryl CoA reductase; 3 hydroxy 3 methylglutaryl Coenzyme A reductase; 3 hydroxymethylglutaryl CoA reductase; 3-hydroxy-3-methylglutaryl CoA reductase (NADPH); 3-hydroxy-3-methylglutaryl-coenzyme A reductase; 3H3M; HMDH_HUMAN; HMG CoA reductase; HMG CoAR; HMG-CoA reductase; Hmgcr; Hydroxymethylglutaryl CoA reductase; LDLCQ3; MGC103269; Red
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	MTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKT
Expression Range	588-887aa
Protein Length	Partial
Mol. Weight	36.0kDa
Research Area	Metabolism
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Catalyzes the conversion of (3S)-hydroxy-3-methylglutaryl-CoA (HMG-CoA) to mevalonic acid, the rate-limiting step in the synthesis of cholesterol and other isoprenoids, thus plays a critical role in cellular cholesterol homeostasis. HMGCR is the main target of statins, a class of cholesterol-lowering drugs.
Subcellular Location	Endoplasmic reticulum membrane; Multi-pass membrane protein. Peroxisome membrane; Multi-pass membrane protein.
Protein Families	HMG-CoA reductase family
Database References	HGNC: 5006 OMIM: 142910 KEGG: hsa:3156 STRING: 9606.ENSP00000287936 UniGene: PMID: 29626418 High HMGCR expression is associated with hypercholesterolemia. PMID: 29678744 The presence of rs17244841 ve rs17238540 mutations in HMGCR causes a significant reduction in total cholesterol and LDL-c levels. PMID: 29096742 A positive relationship emerged between HMG-CoAR, hormone receptors and TAZ/YAP, suggesting a connection between the mevalonate pathway, the hormonal milieu and Hippo in Male breast cancer. Moreover, HMG-CoAR expression may be a favorable prognostic indicator. PMID: 27713571 HMGCR genetic variation is associated with Alzheimer's disease. PMID: 26950278 our study demonstrates A allele of HMGCR rs3846662 acts as a protective factor for late-onset Alzheimer's disease in northern Han Chinese PMID: 27009838 UBXD8 is necessary for sterol-stimulated dislocation of ubiquitylated HMGCR from the endoplasmic reticulum membrane en route to proteasomal degradation, a function dependent on its UBX domain. PMID: 28882874 The docking studies indicate rutin as the best compound that can inhibit HMG-CoA reductase as it had strong binding affinity to the enzyme. PMID: 27216569 Both HMGCR and SQLE promoters have two SREs that may act as a homing region to attract a single SREBP-2 homodimer. PMID: 28342963 To estimate the association between changes in levels of LDL-C (and other lipoproteins) and the risk of cardiovascular events related to variants in the CETP gene, both alone and in combination with variants in the 3-hydroxy-3-methylglutaryl-CoA reductase (HMGCR) gene. PMID: 28846118 Low LDL cholesterol levels due to PCSK9 and HMGCR variants had no causal effect on high risk of Alzheimer's disease, vascular dementia, any dementia, or Parkinson's disease; however, low LDL cholesterol levels may have a causal effect in reducing the risk of Alzheimer's disease. PMID: 28438747 TGF-beta1 induces cholesterol synthesis by increasing HMG-CoA reductase mRNA expression in keratinocytes. PMID: 26932266 Gene expression profile and the biological functions of HMGCR in gastric cancer were studied. It was found that the expression of HMGCR was increased in gastric cancer tissues. Over-expression of HMGCR promoted the growth and migration of gastric cancer cells, while knocking down the expression of HMGCR inhibited the growth, migration and tumorigenesis of gastric cancer cells. PMID: 27085483 In this study, variants in PCSK9 had approximately the same effect as variants in HMGCR on the risk of cardiovascular events and diabetes per unit decrease in the LDL cholesterol level. The effects of these variants were independent and additive. PMID: 27959767 Data show that simvastatin significantly inhibited cellular proliferation, induced cell cycle G1 arrest and apoptosis, and caused cellular stress via reduction in the enzymatic activity of 3-hydroxy-3-methyl-glutaryl-CoA reductase (HMGCR). PMID: 26503475 no associations found between HMGCR rs3846662, HMRCR alternative splicing and Alzheimer's disease pathology pathology. PMID: 26541602 results indicate that abnormal lipid metabolism may exist in spontaneous preterm delivery (SPTD) women and the premature fetus and the HMGCR gene may be a susceptible gene for SPTD PMID: 26301579 Report the mechanism of polyphenol binding to and activity regulation of HMGR using molecular docking. PMID: 26357462 the results of the present study showed that luteolin modulates HMGCR transcription by decreasing the expression and nuclear translocation of SREBP-2. PMID: 26302339 Discovery new drug candidates for inhibition of human HMG-CoA reductase through structure-based virtual screening. PMID: 26170618 Results show that HMGCR rs3846662 acts as a potent genetic modifier for Alzheimer's disease risk, age of onset and conversion from mild cognitively impairment PMID: 25023145 study demonstrated the oncogenic roles of HMGCR in glioblastoma cells and HMGCR might be a promising therapeutic target. PMID: 26432005 the 5-aminoimidazole-4-carboxyamide ribonucleoside (AICAR)-induced activation of AMPK directly inhibited the expression of SREBP-2 and HMGCR and HMGCS, and suppressed the TSH-stimulated up-regulation of SREBP-2 in HepG2 cells. PMID: 25933205 Data show that sterols stimulate binding of prenyltransferase UBIAD1 to HMG CoA reductase, which is subject to sterol-accelerated, endoplasmic reticulum (ER)-associated degradation augmented by the nonsterol isoprenoid geranylgeraniol. PMID: 25742604 Human carotid atherosclerotic lesion protein components decrease cholesterol biosynthesis rate in macrophages through 3-hydroxy-3-methylglutaryl-CoA reductase regulation. PMID: 25639207 miR-21 regulates triglyceride and cholesterol metabolism in non-alcoholic fatty liver disease by targeting HMGCR PMID: 25605429 The effect of lower LDL-C on the risk of coronary heart disease mediated by polymorphisms in NPC1L1, HMGCR, or both is approximately the same per unit lower LDL-C and log-linearly proportional to the absolute exposure to lower LDL-C. PMID: 25770315 promoter DNA hypermethylation of the ABCG1 and GALNT2 genes, but not the HMGCR gene, is associated with an increased risk of CHD. PMID: 25084356 Strong HMGCR expression is associated with high response to radiotherapy in ductal carcinoma-in situ. PMID: 24777857 The results show that carriage of SNPs in the HMGCR gene were associated with bodyweight gain and increased risk of type 2 diabetes PMID: 25262344 HMGCR is differentially expressed in colorectal cancer and that positive expression is associated with favourable tumour characteristics and a prolonged survival in unadjusted analysis. PMID: 24708688 HMGCR is upregulated in hepatocellular carcinoma associated with paraneoplastic hypercholesterolemia. PMID: 23549978 findings show that HNRNPA1 modulates the expression level of an alternatively spliced transcript of HMGCR by regulating splicing and altering RNA stability, resulting in reduced HMGCR enzyme activity and increased LDL-Cholesterol uptake PMID: 24001602 Data indicate that RNAi-mediated knockdown of VCP/p97 blocks sterol-accelerated degradation but not ubiquitination of 3-hydroxy-3-methylglutaryl coenzyme A reduc (HMG CoA reductase) in SV-589 cells. PMID: 24025715 HMGCR-mediated changes in F-actin structure play an important role in the inter-cellular transmission of respiratory syncytial virus infection. PMID: 23994498 Over-expression of HMGCR in esophageal squamous cell carcinoma (ESCC) cells promoted cell growth and migration. PMID: 24390662 knockdown of MARCH6 also controls the level of 3-hydroxy-3-methyl-glutaryl coenzyme A reductase (HMGCR) in hepatocytes and model cell lines PMID: 24449766 Increased cholesterol synthesis mediated by HMGCoA-R under inflammatory stress may be one of the mechanisms for intracellular lipid accumulation and statin resistance. PMID: 24233489 Age and sex modify the contribution of the HMGCR-911 polymorphism to fasting serum total cholesterol, LDL-cholesterol levels and risk of coronary heart disease. PMID: 23933271 These results suggest that dengue virus infection increases intracellular cholesterol levels at early times post infection by triggering the modulation of LDL particles uptake and the increase in the enzymatic activity of HMG-CoA reductase. PMID: 23642566 A novel role for Aup1 in maintenance of intracellular cholesterol homeostasis via mediation of the endoplasmic reticulum associated degradation of HMG-CoA reductase. PMID: 23223569 Statins up-regulate the expression of HMGCR, the major target of autoantibodies in statin-associated immune-mediated necrotizing myopathy. PMID: 21360500 The association of HMGCR promoter region polymorphisms with cholesterol levels and coronary artery disease in patients from Western India are reported. PMID: 22858685 This study was designed to understand the mode of interactions of HMGCR isoform 2 with statins Atorvastatin, Lovastatin, Fluvastatin, Simvastatin, Pravastatin, Rosuvastatin and Cerivastatin. PMID: 22177940 The HMGCR rs3846662 GG genotype was quantitatively documented to be a significant determinant for higher LDL-C level in basal state and possibly in response to atorvastatin. PMID: 21427285 Reductions in plasma insulin may have affected the expression of a key regulatory gene of cholesterol synthesis, HMG-CoA reductase and low-density lipoprotein receptor. PMID: 22024489 HMG-CoA reductase activation and urinary pellet cholesterol elevations in acute kidney injury. PMID: 21799150 HMG-CoA reductase regulation takes place at the levels of transcription, translation, post-translational modification and degradation. (Review) PMID: 21801748 Linalool reduces the expression of 3-hydroxy-3-methylglutaryl CoA reductase via sterol regulatory element binding protein-2- and ubiquitin-dependent mechanisms. PMID: 21944868 inhibition of protein geranylgeranylation markedly attenuated ubiquitylation and dislocation, implicating for the first time a geranylgeranylated protein(s) in the metabolically regulated ERAD of HMGR. PMID: 21778231

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.