Recombinant Human 3 Beta-Hydroxysteroid Dehydrogenase/Delta 5--4-Isomerase Type 1 (HSD3B1) Protein (His&Myc)

Name: Recombinant Human 3 Beta-Hydroxysteroid Dehydrogenase/Delta 5--4-Isomerase Type 1 (HSD3B1) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-01918P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human 3 Beta-Hydroxysteroid Dehydrogenase/Delta 5--4-Isomerase Type 1 (HSD3B1) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P14060
Target Symbol	HSD3B1
Synonyms	HSD3B1; 3BH; HSDB3A; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I; 3-beta-HSD I; 3-beta-hydroxy-5-ene steroid dehydrogenase; 3-beta-hydroxy-Delta(5-steroid dehydrogenase; 3-beta-hydroxysteroid 3-dehydrogenase; Delta-5-3-ketosteroid isomerase; Dihydrotestosterone oxidoreductase; Steroid Delta-isomerase; Trophoblast antigen FDO161G
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLEGDILDEPFLKRACQDVSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTLYTCALRPMYIYGEGSRFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILAL
Expression Range	2-237aa
Protein Length	Partial
Mol. Weight	33.4 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	A bifunctional enzyme responsible for the oxidation and isomerization of 3beta-hydroxy-Delta(5)-steroid precursors to 3-oxo-Delta(4)-steroids, an essential step in steroid hormone biosynthesis. Specifically catalyzes the conversion of pregnenolone to progesterone, 17alpha-hydroxypregnenolone to 17alpha-hydroxyprogesterone, dehydroepiandrosterone (DHEA) to 4-androstenedione, and androstenediol to testosterone. Additionally, catalyzes the interconversion between 3beta-hydroxy and 3-oxo-5alpha-androstane steroids controlling the bioavalability of the active forms. Specifically converts dihydrotestosterone to its inactive form 5alpha-androstanediol, that does not bind androgen receptor/AR. Also converts androstanedione, a precursor of testosterone and estrone, to epiandrosterone. Expected to use NAD(+) as preferred electron donor for the 3beta-hydroxy-steroid dehydrogenase activity and NADPH for the 3-ketosteroid reductase activity.
Subcellular Location	Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.
Protein Families	3-beta-HSD family
Database References	HGNC: 5217 OMIM: 109715 KEGG: hsa:3283 STRING: 9606.ENSP00000358421 UniGene: PMID: 28744792 Fungicide ziram may disrupt the placental steroid production. In the present study, we investigated the effects of ziram on steroid formation in human placental cell line JEG-3 cells and on HSD3B1 and aromatase in the human placenta. Ziram did not inhibit progesterone production in JEG-3 cells and HSD3B1 activity at 100muM... ziram is a potent inhibitor of human aromatase. PMID: 28951168 This is the first study to indicate that 3beta-HSD type 1 is a potent prognostic factor in hormone-dependent breast cancer. PMID: 27139182 HSD3B1 is involved in aldosterone production, despite its lower levels of expression compared with HSD3B2, and also possibly associated with KCNJ5 mutation in aldosterone-producing adenoma. PMID: 25458695 Expression of the genes HSD3B1, HSD17B3, and SRD5A2 was significantly increased in BPH tissues compared to normal adjacent prostate tissues. PMID: 24810473 prostate cancer patients who harbored the heterozygous variant HSD3B1 (1245C) are more likely to develop to castration-resistant prostate cancer but do not have shorter time to biochemical recurrence, shorter survival time or higher mortality risk PMID: 25731771 No evidence to support that HSD3B1 is involved in aldosterone synthesis in the human adrenal cortex or that genetic variation in HSD3B1 affects blood pressure or hypertension. PMID: 24951726 Results indicate that orexin-A significantly enhanced the expression of 3beta-hydroxysteroid dehydrogenase (3beta-HSD) and the production of cortisol, and increased the phosphorylation of AKT protein in the NCI-H295R adrenocortical cells. PMID: 25319929 The data of this study supports a strongly positive association between mitochondrial complex I gene variations and MS pathogenesis in a Filipino population. PMID: 25172194 The AAT haplotype of the HSD3B1 gene was significantly associated with increased risks of acne vulgaris in Han Chinese from the Southwest China. PMID: 24157973 HSD3B1 T-->C Leu338, HTR2A T102C, GNAS T393C, and RGS2 G638A polymorphisms were not associated with hypertension risk. PMID: 23859711 Risk-conferring genetic variations in the HSD3beta gene influenced susceptibility of primary aldosteronism. Concomitant presence of rs6203 CC and rs12410453 GA genotypes synergistically increased aldosterone-to-renin ratio PMID: 24006038 Study shows that castration-resistant prostate cancer sometimes expresses a gain-of-stability mutation that leads to a gain-of-function in 3betaHSD1, which catalyzes the initial rate-limiting step in conversion of the adrenal-derived steroid dehydroepiandrosterone to dihydrotestosterone. PMID: 23993097 elevated in placental tissue of women with polycystic ovarian syndrome PMID: 23122578 HSD3B1 is a highly specific trophoblast-associated marker that can be used in the distinction of trophoblastic tumorlike lesions and tumors from nontrophoblastic lesions and tumors. PMID: 23318910 The aim of this haplotype-based case-control study was to estimate whether polymorphisms of the maternal estrogen synthesis genes (CYP19A1, HSD3B1 and HSD3B2) are associated with preeclampsia and gestational hypertension PMID: 22638611 Carriers of HSD3B1 GCC haplotype had lower peak early (Ea; P = 0.004) and higher peak late (Aa; P = 0.066) diastolic mitral annular velocities and therefore a lower Ea/Aa ratio (P = 0.041) as compared with noncarriers PMID: 22673022 The HSD3B1 T/C polymorphism cannot be used as genetic marker for the risk for recurrent spontaneous abortions in our Caucasian population. PMID: 21631238 There is expression of 3beta-Hsd1 in XX gonads during gonad differentiation period. PMID: 21932034 rs6203 and rs1047303 in the HSD3B1 gene are useful genetic markers for essential hypertension, while polymorphisms of HSD3B1 are associated with the BP and aldosterone level. PMID: 20660004 The study identifies an amino acid in the steroid binding domain of human 3-beta-HSD I that may be exploited to produce new inhibitors that are much more highly specific for 3-beta-HSD I in breast tumors compared to adrenal 3-beta-HSD II. PMID: 20420909 We investigated associations between single nucleotide polymorphisms in genes HSD3B1, SRD5A1/2, and AKR1C2 and prostate cancer risk PMID: 20056642 Data indicate that enzymes CYP17A1 and HSD3B1 showed low expression, while AKR1C3 and SRD5A1 were abundantly expressed. PMID: 20086173 nonstop mutation in the stop codon and missense mutation in type II 3beta-hydroxysteroid dehydrogenase gene causing 3beta-HSD deficiency congenital adrenal hyperplasia. PMID: 12050213 Polymorphism in exon 4 of the human gene and blood presssure PMID: 12054649 Structure/function relationships responsible for the kinetic differences between isoforms PMID: 12205101 HSD3B1 was identified using a trifunctional phenyl sulfonate probe. PMID: 12438565 Substantially higher affinity of 3beta-HSD1 activity for substrate and inhibitor steroids relative to the 3beta-HSD2 enzyme. PMID: 12530651 In outer region of adrenal cortex immunoreactivity was observed for 3beta-hydroxysteroid dehydrogenase. PMID: 12530676 Structure/function relationships responsible for coenzyme specificity and the isomerase activity of this multienzyme complex. PMID: 12832414 Descending HSD3B phenotype in hyperandrogenic females is associated with a variant of insulin-resistant polycystic ovary syndrome. PMID: 14764797 Neither of the HSD3B1 or PTP1B variants were associated with hypertension PMID: 15097232 results designate YY1 as the factor responsible for the intron 1-mediated boost of the HSD3B2 gene basal promoter activity PMID: 15291746 further characterizes structure/function relationships of human 3beta-HSD and bring us closer to the goal of selectively inhibiting the type 1 enzyme in placenta to control the timing of labor or in hormone-sensitive breast tumors to slow their growth PMID: 15291757 identification of structural reasons for the substantially higher affinities of 3beta-HSD1 for substrates, coenzymes, and inhibitors PMID: 15797861 The Rossmann-fold domain of 3beta-HSD1 contains two Cys residues, Cys72 and Cys111, which are capable of forming an intrasubunit disulfide bond based on their proximity in our structural model. PMID: 17624763 Variant in the HSD3B1 gene is associated with increased mammographic density PMID: 17627014 There is a possible role in human disease of common genetic variation in HSD3B1 and HSD3B2. PMID: 17689071 results suggest that the HSD3B1 N367T and UGT2B17 null polymorphisms may modify the risk of prostate cancer, particularly among men with a family history of the disease PMID: 17826523 HSD3B1 is highly specific and sensitive compared with other trophoblastic markers dor differential diagnosis of trophoblastic tumors and tumorlike lesions.. PMID: 18223326 Structure/function of the inhibition of HSD3B1 by trilostane is reported. PMID: 18524572 The activity levels of 17beta-hydroxysteroid dehydrogenase (17beta-HSD), 3beta-hydroxysteroid dehydrogenase (3beta-HSD), 3alpha-hydroxysteroid dehydrogenase (3alpha-HSD/3-KSR) and estrone sulfatase in ovarian epithelial carcinomas, were assayed. PMID: 18723074 Anti-inflammatory effects of IL-1alpha and IL-4 on 3beta-HSD2 mRNA involve a p38 MAPK signalling pathway, whereas pro-inflammatory response of IL-1alpha to 3beta-HSD1 mRNA involves a NF-kappaB inflammatory pathway. PMID: 18778748 The high affinity, competitive inhibition of 3beta-HSD1 by trilostane and epostane may be related to the presence of Arg195 in 3beta-HSD1 vs. Pro195 in 3beta-HSD2. PMID: 18955108 The genetic polymorphisms of the HSD3B1,genes were found to be significantly different (p<0.05) between the uremic and non-uremic diabetes group PMID: 19148546 Among patients with essential hypertension, cholesterol side-chain cleavage & MDR1 loci are related to circulating endogenous ouabain & DBP. In contrast, variants in HSD3B1 are related with SBP probably via aldosterone PMID: 19197249 3beta-HSD protein was immunodetectable in primary ascites of women who were diagnosed with epithelial ovarian cancer but mRNA transcripts of both 3beta-hydroxysteroid dehydrogenase type 1 and type 2 were diminished relative to normal cells. PMID: 19414525 compared (+)- and (-)-gossypols in the inhibition of 3beta-HSD and 17beta-HSD3 in human and rat testes PMID: 19429456

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.