Recombinant Human 14-3-3 Protein Zeta/Delta (YWHAZ) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10960P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human 14-3-3 Protein Zeta/Delta (YWHAZ) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10960P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human 14-3-3 Protein Zeta/Delta (YWHAZ) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P63104
Target Symbol YWHAZ
Synonyms 14 3 3 delta; 14 3 3 protein zeta/delta; 14 3 3 protein/cytosolic phospholipase A2; 14 3 3 zeta; 14-3-3 protein zeta/delta; 1433Z_HUMAN; Epididymis luminal protein 4; Epididymis secretory protein Li 3; HEL S 3; HEL4; KCIP-1; KCIP1; MGC111427; MGC126532; MGC138156; Phospholipase A2; Protein kinase C inhibitor protein 1; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein; delta polypeptide; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein; zeta; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein; zeta polypeptide; Tyrosine 3/tryptophan 5 monooxygenase activation protein; zeta polypeptide; YWHAD; YWHAZ
Species Homo sapiens (Human)
Expression System Yeast
Tag C-6His
Target Protein Sequence AEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
Expression Range 1-245 aa
Protein Length Full Length
Mol. Weight 20.6 kDa
Research Area Cell Biology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Induces ARHGEF7 activity on RAC1 as well as lamellipodia and membrane ruffle formation. In neurons, regulates spine maturation through the modulation of ARHGEF7 activity.
Subcellular Location Cytoplasm. Melanosome. Note=Located to stage I to stage IV melanosomes.
Protein Families 14-3-3 family
Database References

HGNC: 12855

OMIM: 601288

KEGG: hsa:7534

STRING: 9606.ENSP00000309503

UniGene: PMID: 28522826

  • These results imply that disorder in the N-terminal helices of 14-3-3 zeta is a consequence of the dimer-monomer dynamics and may play a role in conferring chaperone function to 14-3-3 zeta protein. PMID: 29109150
  • Knockdown of YWHAZ inhibited cell cycle progression, migration, and the expression of stem cell markers and tumorigenicity was suppressed in tumor-bearing BALB/c nude mice. The expression of YWHAZ was directly down-regulated by miR-30e in resistant ovarian cancer cells. PMID: 30134224
  • our data suggest miR-204 and 14-3-3zeta as potential therapeutic targets in osteosarcoma PMID: 29441884
  • evidence is lacking to conclude that 14-3-3zeta is a useful marker of tamoxifen resistance. PMID: 28643021
  • TRIM21 positively regulated osteosarcoma cell proliferation. Overexpression of TRIM21 enhanced osteosarcoma cell tolerance toward various stresses. YWHAZ protein was identified as a novel interacting partner of TRIM21 and its expression levels were negatively regulated by TRIM21. PMID: 29673441
  • several disordered regions of PI4KB become protected from proteolytical degradation upon 14-3-3 binding. PMID: 28864297
  • Ectopic expression of miR-451 could inhibit the cell migration and invasion, promoted apoptosis, induced cell-cycle arrest Furthermore, tyrosine3-monooxygenase/tryptophan5-monooxygenase activation protein zeta (YWHAZ) was identified as a direct target of miR-451 PMID: 28981108
  • Serum autoantibodies to YWHAZ are produced at substantially greater levels in gastric cancer patients as compared to controls. PMID: 28944820
  • Dimerization of 14-3-3 zeta (14-3-3zeta) dimer was disrupted by a double mutant (L12E, M78K). PMID: 29203375
  • Results identified YWHAZ as the direct target of miR-613 in hepatocellular carcinoma (HCC). Its overexpression reverses the tumor suppressing role of miR-613 in HCC cells. PMID: 29551505
  • 14-3-3zetaoverexpression might be a potential prognostic biomarker for ovarian cancer. PMID: 29214776
  • In AML patients, low level of miR-451 is negatively correlated with high levels of c-Myc and YWHAZ, while c-Myc level is positively related to YWHAZ expression. These results suggested that c-Myc dash, verticalmiR-451 dash, verticalYWHAZ/AKT cascade might play a crucial role during leukemogenesis, and reintroduction of miR-451 could be as a potential strategy for AML therapy. PMID: 27764807
  • miR-22 exhibits tumor-suppressive effects in hepatocellular carcinoma cells by regulating YWHAZ/AKT/FOXO3a signaling. PMID: 27811373
  • our data demonstrate that overexpression of 14-3-3zeta in early stage pre-cancerous breast epithelial cells may trigger an elevated glycolysis and transcriptionally up-regulating LDHA, thereby contributes to human breast cancer initiation. PMID: 27150057
  • 14-3-3zeta can bind to the FOXO3a transcription factor to promote the export of the complex to the cytoplasm, leading to enhanced proliferation and migration of tongue cancer cells. PMID: 27080223
  • Structure of the complex of phosphorylated liver kinase B1 and 14-3-3zeta has been reported. PMID: 28368277
  • These results suggest that the hypoxia/14-3-3zeta/HIF-1alpha pathway plays an important role in portal vein tumor thrombus formation and hepatocellular carcinoma metastasis PMID: 26910835
  • 14-3-3zeta recruited YAP and p-LATS to form a complex under high cells density status and 14-3-3zeta other than YAP or phospho-LATS was the key regulatory molecule of this complex. PMID: 27334574
  • This study shows that human procaspase-2 interaction with 14-3-3 zeta is governed by phosphorylation at both S139 and S164. PMID: 28943433
  • The results highlight a new role of TSC2 in protecting glioblastoma against photodynamic therapy-induced cell death, and TSC2 and YWHAZ as new RIP3 partners. PMID: 27984090
  • These results suggest that 14-3-3-zeta is involved in the TLR3-TICAM-1 pathway in promoting multimerization of TICAM-1 for the formation of a TICAM-1 signalosome. PMID: 27058640
  • The data indicate that microtubule-bound tau is resistant to 14-3-3zeta-induced tau aggregation and suggest that tau phosphorylation promotes tau aggregation in the brain by detaching tau from microtubules and thus making it accessible to 14-3-3zeta. PMID: 27548710
  • Structural interface between LRRK2 and 14-3-3 delta protein has been presented. PMID: 28202711
  • 14-3-3zeta-mediated invasion of cancer cells was found to upregulate Snail through the activation of atypical protein kinase C (aPKC). PMID: 27554601
  • results have identified a novel mechanism by which 14-3-3sigma maintains the epithelial phenotype by inhibiting Epithelial to Mesenchymal Transition and suggest that this property of 14-3-3sigma might contribute to its function as a tumor suppressor gene. PMID: 27261462
  • 14-3-3zeta regulates HIF-1alpha production in hepatocellular carcinoma cells by directly binding to HIF-1alpha and via PI3K/Akt/NF-small ka, CyrillicB signal transduction pathway. PMID: 26884855
  • Results indicate that HuR induces 14-3-3zeta translation via interaction with its 3' UTR and that 14-3-3zeta is necessary for stimulation of intestinal epithelial cell migration after wounding. PMID: 27401462
  • this study suggests that the down-regulation of 14-3-3 zeta leads to the inhibition of TGFb1- induced contraction by decreasing the expression of total RhoA in TM cells. PMID: 26906158
  • loss of expression or even the down-regulation of c-abl, but not WYHAZ, is a fundamental event that leads to genesis and progression of tumors PMID: 26429164
  • This study provides the molecular basis for C-Raf C-terminal-derived phosphopeptide interaction with 14-3-3zeta protein and gives structural insights responsible for phosphorylation-mediated protein binding. PMID: 26295714
  • 14-3-3z may play an important role in signaling pathway in breast cancer. Also, a high 14-3-3z expression could positively regulate growth factor receptors and protein kinase pathways PMID: 25861752
  • Studies show that 14-3-3zeta is overexpressed in oral squamous cell carcinoma and provide evidence that may regulate tumor inflammation and immune response through Stat3 signaling. PMID: 25556369
  • Activation of PCTAIRE-1 is mediated through interaction with the phosphorylated form of cyclin Y in complex with 14-3-3. PMID: 26205494
  • C-terminal domain of Pdc interacts with the outside surface of the 14-3-3 dimer. PMID: 25971962
  • Our findings indicate that YWHAZ could serve as a promising prognostic biomarker in localized PCa to predict poor prognosis PMID: 25156059
  • studyconfirmed the interaction of Ser9-phosphorylated GSK3beta with 14-3-3zeta; Ser9-phosphorylation of GSK3beta promoted by 14-3-3zeta is critical for the activation of NF-kappaB pathway PMID: 25138042
  • A detailed analysis of the interaction between singly or doubly phosphorylated human tyrosine hydroxylase isoform 1(1-50) peptides and 14-3-3zeta PMID: 25418103
  • BIS targeting induces cellular senescence through the regulation of 14-3-3 zeta/STAT3/SKP2/p27 in glioblastoma cells. PMID: 25412315
  • Aberrant upregulation of 14-3-3sigma and EZH2 expression serves as an inferior prognostic biomarker for hepatocellular carcinoma. PMID: 25226601
  • The 14-3-3zeta-driven contextual changes of Smad partners from p53 to Gli2 may serve as biomarkers and therapeutic targets of TGF-b-mediated cancer progression. PMID: 25670079
  • Among the genes found disrupted in this study, there is evidence suggesting that YWHAZ and also the X-linked DRP2 may be considered as novel autism candidate genes. PMID: 23999528
  • Data found that the interaction between 14-3-3 zeta and Atg9A is mediated by phosphorylation at Ser761. PMID: 25266655
  • miR-375-mediated regulation of 14-3-3zeta contributes to decrease telomerase activity by altering nuclear translocation of TERT. PMID: 24708873
  • 14-3-3zeta regulates nuclear trafficking of PP1alpha in mammalian cells PMID: 24956593
  • By preventing the inactivation of cofilin, metabolic stress-induced degradation of 14-3-3zeta promotes the conversion of blood monocytes into a hypermigratory, proatherogenic phenotype. PMID: 24812321
  • Compared to HL-60 cells, multidrug-resistant HL-60/VCR cells had increased 14-3-3zeta mRNA and protein expression.Silencing of 14-3-3zeta increased the sensitivity of both sensitive and resistant HL-60 cells to TPT-induced apoptosis. PMID: 24603438
  • 14-3-3zeta causes synaptic loss by destabilizing microtubules, leading to proteosomal degradation of synaptophysin in the neurons of patients suffering from Alzheimer's disease. PMID: 24367683
  • Data suggest that the combined expression of 14-3-3zeta and Hsp27 may be a biomarker for predicting survival in patients with NSCLC, and this combination may have potential as a therapeutic target for NSCLC. PMID: 24804299
  • Somatic copy number alterations by whole-exome sequencing implicates YWHAZ and PTK2 in castration-resistant prostate cancer. PMID: 24114522
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed