Recombinant Human 14-3-3 Protein Sigma (SFN) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-10062P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human 14-3-3 Protein Sigma (SFN) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-10062P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human 14-3-3 Protein Sigma (SFN) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P31947 |
Target Symbol | SFN |
Synonyms | 14 3 3 protein sigma; 14-3-3 protein sigma; 1433S_HUMAN; Epithelial cell marker protein 1; Er; HME 1; HME1; MGC143283; Mkrn3; Mme1; OTTHUMP00000004242; RP23 137L22.11; SFN; SFN protein; Stratifin; YWHAS |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS |
Expression Range | 1-248aa |
Protein Length | Full Length |
Mol. Weight | 54.8kDa |
Research Area | Neuroscience |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway. May also regulate MDM2 autoubiquitination and degradation and thereby activate p53/TP53.; p53-regulated inhibitor of G2/M progression. |
Subcellular Location | Cytoplasm. Nucleus. Secreted. Note=May be secreted by a non-classical secretory pathway. |
Protein Families | 14-3-3 family |
Database References | HGNC: 10773 OMIM: 601290 KEGG: hsa:2810 STRING: 9606.ENSP00000340989 UniGene: PMID: 27760737 |