Recombinant Human 14-3-3 Protein Eta (YWHAH) Protein (GST)

Name: Recombinant Human 14-3-3 Protein Eta (YWHAH) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-02354P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) YWHAH.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human 14-3-3 Protein Eta (YWHAH) Protein (GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q04917
Target Symbol	YWHAH
Synonyms	14 3 3 protein eta; 14-3-3 eta; 14-3-3 protein eta; 1433F_HUMAN; Brain protein 14-3-3; eta isoform; HGNC:12853; Protein AS1; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein 1; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein eta polypeptide; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein; eta isoform; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein; eta; Tyrosine 3/tryptophan 5 monooxygenase activation protein eta polypeptide; YWHA 1; YWHA1; Ywhah
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	REQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
Expression Range	4-246aa
Protein Length	Partial
Mol. Weight	54.9kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1.
Protein Families	14-3-3 family
Database References	HGNC: 12853 OMIM: 113508 KEGG: hsa:7533 STRING: 9606.ENSP00000248975 UniGene: PMID: 29512774 The impact of AKT1 on glucocorticoid receptor (GR)-induced transcriptional activity in cooperation with phospho-serine/threonine-binding protein 14-3-3, was examined. PMID: 27717743 14-3-3 eta isoform colocalizes TDP-43 on the coarse granules in the anterior horn cells of patients with sporadic amyotrophic lateral sclerosis. PMID: 27256400 Extracellular 14-3-3eta activates key signalling cascades and induces factors associated with the pathogenesis of rheumatoid arthritis PMID: 24751211 This study identified YWHAH significantly associated loci with a biologically plausible role in schizophrenia. PMID: 24507884 14-3-3eta may be required for mitotic progression and may be considered as a novel anti-cancer strategy in combination with microtubule inhibitors. PMID: 22562251 This is the first genetic association study of YWHAH with sporadic Creutzfeldt-Jakob disease populations. PMID: 21739144 relocation of p33ING1b from the nucleus to the cytoplasm, where the protein is tethered by 14-3-3eta, participates in tumorigenesis and progression in HNSCC PMID: 21432775 The 14-3-3 eta, beta, gamma and sigma isoforms were negatively expressed in meningioma PMID: 20388496 phosphorylation of 14-3-3 binding site of myeloid leukemia factor 1 by MADM PMID: 12176995 Data demonstrate that 14-3-3 proteins are colocalized with Lewy bodies in Parkinson disease, but there was no specific staining for the 14-3-3 eta subunit. PMID: 12480176 gremlin 1 is overexpressed in human cancers and interacts with YWHAH protein PMID: 16545136 The association of YWHAH with bipolar disorder in a large sample, consisting of 1211 subjects from 318 nuclear families including 554 affected offspring, was investigated. PMID: 19160447

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.