Recombinant Human 14-3-3 Protein Beta/Alpha (YWHAB) Protein (GST)

Name: Recombinant Human 14-3-3 Protein Beta/Alpha (YWHAB) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-10687P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human 14-3-3 Protein Beta/Alpha (YWHAB) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P31946
Target Symbol	YWHAB
Synonyms	14 3 3; 14 3 3 protein beta; 14 3 3 protein beta/alpha; 14 3 3 protein zeta; 14 3 3 zeta; 14-3-3 protein beta/alpha; 14-3-3 protein/cytosolic phospholipase A2; 1433B_HUMAN; GW128; HS1; KCIP 1; KCIP-1; MGC111427; MGC126532; MGC138156; N-terminally processed; Protein 1054; Protein kinase C inhibitor protein 1; Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein; delta polypeptide; Tyrosine 3/tryptophan 5 -monooxygenase activation protein; zeta polypeptide; YWHAB; YWHAD; YWHAZ
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
Expression Range	1-246aa
Protein Length	Full Length
Mol. Weight	55.1kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negative regulator of osteogenesis. Blocks the nuclear translocation of the phosphorylated form (by AKT1) of SRPK2 and antagonizes its stimulatory effect on cyclin D1 expression resulting in blockage of neuronal apoptosis elicited by SRPK2. Negative regulator of signaling cascades that mediate activation of MAP kinases via AKAP13.
Subcellular Location	Cytoplasm. Melanosome.
Protein Families	14-3-3 family
Database References	HGNC: 12849 OMIM: 601289 KEGG: hsa:7529 STRING: 9606.ENSP00000300161 UniGene: Hs.643544

Gene Functions References

14-3-3beta protein activates Pseudomonas exotoxin-S and exotoxin-T ADP-ribosyltransferase domains by chaperoning their hydrophobic surfaces independently of the amphipathic C-terminal segment. PMID: 30224724
Data show that 14-3-3beta protein augmented the expression of matrix metalloproteinasea MMP2 and MMP9 through PI3 kinase/Akt protein/NF-kappaappa B pathway, thereby enhancing the invasiveness of hepatocellular carcinoma (HCC) cells. PMID: 26730736
These findings indicate that 14-3-3beta and gamma are novel PPARgamma2 regulators and are involved in hepatic lipid metabolism. 14-3-3b and gamma can be therapeutic target molecules to treat non-alcoholic fatty liver disease. PMID: 26260846
miR-152 controls both the expression of 14-3-3beta and HLA-G and exerts a dual role in tumor cells by both altering the immunogenicity and the tumorigenicity PMID: 25228695
Data suggest that serum 14-3-3beta concentrations may constitute a useful marker for blood brain barrier damage severity and follow up in patients with eosinophilic meningitis caused by Angiostrongylus cantonensis. PMID: 24555778
Using gene reporter assays, we show that promoter variations in 11 intrinsic apoptosis genes, including ADPRT, APAF1, BCL2, BAD, BID, MCL1, BIRC4, BCL2L1, ENDOG, YWHAB, and YWHAQ, influence promoter activity in an allele-specific manner. PMID: 24038028
Crystal structure of Myo1c/14-3-3beta complex, which has been implicated in the exocytosis of glucose transporter 4 storage vesicles during insulin-stimulated glucose uptake. PMID: 24636949
Data identified three classes of 14-3-3 targets that all have two binding sites, but displayed synergistic interaction between converging signalling pathways for different ranges of parameter values. PMID: 24269229
These results indicate that the six YWHAB polymorphisms are not associated with the genetic susceptibility to sporadic Creutzfeldt-Jakob disease. PMID: 23053962
14-3-3beta binding to phosphorylated CFTR augments its biogenesis by reducing retrograde retrieval of CFTR to the endoplasmic reticulum. This mechanism permits cAMP/PKA stimulation to make more CFTR available for anion secretion. PMID: 22278744
Data identified 14-3-3beta as a prognostic biomarker. PMID: 22125622
Modulation of matrix metalloproteinase 1 by 14-3beta/alpha, may be important in the alteration of collagenase production associated with airway remodelling in obstructive lung diseases PMID: 21948273
Analyses show that high cytoplasmic levels of 14-3-3beta and epsilon independently correlate with poor disease-specific survival in vulvar squamous cell carcinoma cases. PMID: 21935479
In glioblastoma PTPIP51 expression increases with the grade of malignancy and PTPIP51 interacts in situ with 14-3-3ss and PTP1B. PMID: 21972092
Studies indicate that Akt phosphorylates acetylated-FoxO and then phosphorylated FoxO interacts with 14-3-3 proteins in the nucleus, which in turn results in cytoplasmic retention of FoxO. PMID: 21396404
Studies indictet that the mammalian FoxO family consists of FoxO1, 3, 4 and 6 and are regulated by by AKT and 14-3-3 proteins. PMID: 21708191
The expression levels of 14-3-3 protein beta/alpha were higher in urine samples from patients with renal cell carcinoma than in samples from healthy volunteers. PMID: 21553213
Data indicate that gene analysis revealed an up-regulation of all four 14-3-3 isoforms beta, eta, gamma, and sigma. PMID: 21416292
14-3-3beta protein has the potential to be used as a diagnostic and prognostic biomarker in gastric cancer. PMID: 21598387
14-3-3beta interacts with human Dapper1, attenuating the ability of hDpr1 to promote Dishevelled (Dvl) degradation, thus enhancing Wnt signaling PMID: 21262972
protein within PIV5-infected cells is phosphorylated at residue S369, binds the 14-3-3 protein, and is held away from sites of virus budding. PMID: 21147917
14-3-3 eta, beta, gamma and sigma isoforms were negatively expressed in meningioma PMID: 20388496
Show that viral infection activates 14-3-3 protein mediated signaling pathways in human keratinocytes. PMID: 20070120
Study identified an overrepresentation of focal amplifications of known (FGFR3, CCND1, MYC, MDM2) and novel candidate genes (MYBL2, YWHAB and SDC4) in stage Ta bladder carcinoma. PMID: 19821490
14-3-3beta, 14-3-3gamma, 14-3-3epsilon, 14-3-3eta and 14-3-3theta isoforms interact with the GPIb-IX complex in platelets PMID: 19558434
Results show that three 14-3-3 isoforms, beta, gamma and eta, are DAL-1/Protein 4.1B-binding proteins. PMID: 11996670
TSC2 associates with 14-3-3 in vivo PMID: 12364343
KCNK3 potassium channels are shown to bear two cytoplasmic trafficking motifs: an N-terminal dibasic site that binds beta-COP to hold channels in ER and a C-terminal "release" site that binds the ubiquitous intracellular regulator 14-3-3beta PMID: 12437930
14-3-3 beta interacts with the TSC1-TSC2 complex and negatively regulates the function of the TSC proteins PMID: 12468542
14-3-3 binds to the IGF-1 receptor after IGF1R's serine autophosphorylation PMID: 12482592
MK2 phosphorylates TSC2, which creates a 14-3-3 binding site and thus regulates the cellular function of the TSC2 tumor suppressor protein PMID: 12582162
14-3-3beta is a p90 ribosomal S6 kinase (RSK) isoform 1-binding protein that negatively regulates RSK kinase activity PMID: 12618428
Immunoexpression of 14-3-3 proteins in glial cytoplasmic inclusions of multiple system atrophy. PMID: 12669242
These findings suggest that deregulation of 14-3-3 protein amounts might contribute to the development of tumors in tuberous sclerosis patients. PMID: 14680818
HS1 with EPEP insertion polymorphism transmits accelerated signals from B cell receptor and is involved in pathogenesis of systemic lupus erythematosus. PMID: 15022330
novel binding site on 14-3-3 for integrin beta1 and a functional amphipathic groove, rather than its interaction with integrin beta1, is required for 14-3-3 regulation of cell spreading and migration. PMID: 15389601
decreased expression of selected 14-3-3 genes is a common feature of schizophrenia PMID: 15726117
These data show a novel interaction for 14-3-3 with NFL mRNA, and suggests that 14-3-3 may play a role in regulating NFL mRNA stability. PMID: 17098443
14-3-3beta binds DYRK1A PMID: 17229891
PBF is a new cellular factor mediating the effects of PI3K/Akt signaling and 14-3-3 on cell growth PMID: 17531190
Ror2 induces osteogenic differentiation, at least in part, through a release of the 14-3-3beta-mediated inhibition PMID: 17717073
A new regulatory mechanism of myosin light-chain phosphatase via the interaction between 14-3-3 and MYPT1, is reported. PMID: 18094049
changes in the expression of five 14-3-3 isoforms (beta, gamma, epsilon, tau, and zeta) during the apoptosis of JURL-MK1 and K562 cells. PMID: 19173300
Tyrosine 3-monooxygenase/tryptophan S-monooxygenase activation protein, beta polypeptide is decreased during acute lung injury more in mice deficient in metallothionein 1/2 PMID: 16166738

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.