Recombinant Human 11-Beta-Hydroxysteroid Dehydrogenase Type 2 (HSD11B2) Protein (His)

Name: Recombinant Human 11-Beta-Hydroxysteroid Dehydrogenase Type 2 (HSD11B2) Protein (His)
Brand: Beta LifeScience
SKU: BLC-04720P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human 11-Beta-Hydroxysteroid Dehydrogenase Type 2 (HSD11B2) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P80365
Target Symbol	HSD11B2
Synonyms	11 beta HSD2; 11 beta hydroxysteroid dehydrogenase type 2; 11 DH2; 11-beta-HSD2; 11-beta-hydroxysteroid dehydrogenase type 2; 11-DH2; AME; AME1; Corticosteroid 11 beta dehydrogenase isozyme 2; Corticosteroid 11-beta-dehydrogenase isozyme 2; DHI2_HUMAN; HSD11B2; HSD11K; HSD2; Hydroxysteroid 11 beta dehydrogenase 2; Hydroxysteroid 11 beta dehydrogenase isoenzyme 2; NAD dependent 11 beta hydroxysteroid dehydrogenase ; NAD-dependent 11-beta-hydroxysteroid dehydrogenase; SDR9C3; Short chain dehydrogenase/reductase family 9C; member 3
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR
Expression Range	1-405aa
Protein Length	Full Length
Mol. Weight	46.1kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids.
Subcellular Location	Microsome. Endoplasmic reticulum.
Protein Families	Short-chain dehydrogenases/reductases (SDR) family
Database References	HGNC: 5209 OMIM: 218030 KEGG: hsa:3291 STRING: 9606.ENSP00000316786 UniGene: PMID: 29229168 High systemic 11beta-HSD2 activity in preeclampsia but not in intrauterine growth retardation suggests an increased cortisol deactivation in maternal tissue in preeclampsia rather than in the placenta. PMID: 29523277 Analyses demonstrated a trend in the association between maternal trait anxiety and depression symptoms with placental gene expression of NR3C1. We found a significant interaction with maternal ethnicity. In Caucasians only, prenatal trait anxiety and depressive symptoms were associated with an increase in placental NR3C1 expression, and prenatal life events were associated with a down regulation of HSD11B2 PMID: 29100173 mutations that allow the formation of an inactive dimer, alter substrate/coenzyme binding, or impair structural stability of HSD11B2 yield severe apparent mineralocorticoid excess (AME). In contrast, mutations that cause an indirect disruption of substrate binding or mildly alter intramolecular interactions result in type 2 AME. PMID: 29229831 Six sequence variations were observed. Four mutations were indicated in the coding region of HSD11B2 and the other two in 3'-UTR. Two SNPs: c.468C > A and c.534G > A were found to be in total disequilibrium. High variability in HSD11B2 sequence was indicated in the study population, but the relevance of observed SNPs to gestational hypertension or pre-eclampsia development was not confirmed. PMID: 27686600 the role of 11beta-HSD2 in determining birth weight PMID: 28502862 SUMOylation of 11beta-HSD2 at residue K266 modulates cortisol-mediated MR nuclear translocation independently of effects on transactivation. PMID: 28938454 11beta-HSD2 activity is not reduced in patients with drug resistant hypertension, suggesting that variation in the conversion of cortisol to cortisone does not contribute to development of antihypertensive treatment resistance. PMID: 28180242 abundantly localized in syncytial layer of the chorionic villi and the decidual epithelium PMID: 27697223 The data demonstrate for the first time that 11b- HSD2 plays a key role in the pathophysiology of malignant epidermal cells. PMID: 28797028 DNA sequence analysis of affected members of Apparent mineralocorticoid excess family revealed homozygous c.799A>G mutations within exon 4 of HSD11B2, corresponding to a p.T267A mutation of 11betaHSD2. PMID: 27526338 activation of Hedgehog signaling is crucial for the upregulation and maintenance of 11beta-HSD2 expression in placenta PMID: 27379371 Rac1 GTPase regulates 11beta-HSD2 expression, mineralocorticoid receptor activation, and mineralocorticoid receptor-mediated pro-fibrotic signaling. PMID: 28320863 enhancer of zeste homolog 2 (EZH2) accounts for the silence of 11beta-HSD2 expression via trimethylation of histone H3 lysine 27 at the promoter of the 11beta-HSD2 gene. PMID: 28302719 Sensitivity to glucocorticoids did not appear to be mediated by changes in the expression of the beta variant of the glucocorticoid receptor or the 11-beta hydroxysteroid dehydrogenase 2 isozyme. PMID: 26963327 Review of the role of HSD11B2 in pregnancy complications, fetal diseases, and later life morbidity. PMID: 27018008 Since increased DNA methylation in HSD11B2 and FKBP5 are seen in a minority of bisulfite sequencing clones, these epigenetic changes, and functional consequences, may affect subpopulations of placental cells. PMID: 27013342 significant positive correlation between DNA methylation of 11beta-HSD2 CpG 1 in infants and maternal sensitivity. PMID: 26822444 The 11beta-HSD2 expression decreased in pre-eclamptic women of Chinese Han ethnicity, but was not interrelated with the promoter methylation status. PMID: 25331012 zearalenone is a selective inhibitor of HSD11B2, implying that this agent may cause excessive glucocorticoid action in local tissues such as kidney and placentas. PMID: 26798634 Infants with the high-risk neurobehavioral profile showed more methylation than infants with the low-risk neurobehavioral profile at CpG3 for NR3C1 and less methylation of CpG3 for HSD11B2. PMID: 26585459 The CA-repeat length did not influence BP levels or serum F/E ratios in pediatric subjects. However, the serum F/E ratio was associated with BP, suggesting a role of 11betaHSD2 in mineralocorticoid hypertension. PMID: 25907225 growth potential of fetus related to the 11beta-HSD2 expression in the placenta, and 11beta-HSD2 expression related to the trace metals status of the mother PMID: 26462907 maternal depression and anxiety may impact on fetal programming by down-regulating HSD11B2, and antidepressant treatment alone is unlikely to protect against this effect. PMID: 26593902 Data show that glucocorticoid response genes NR3C1, ADCYAP1R1 and HSD11B2 were relatively hypomethylated whereas FKBP5 was hypermethylated. PMID: 26343289 No interaction was found between HSD11B2 and exposure during pregnancy, but individuals with the A allele of rs5479 had an increased risk of schizophrenia after exposure at age 3-9 years PMID: 26115144 11betaHSD2 inhibition suppressed lung tumor growth and invasion in association with increased tissue active glucocorticoid levels, decreased COX-2 expression, inhibition of ERK and mTOR signaling pathways. PMID: 26011146 A novel HSD11B2 functional mutation accounting for an Ala221Gly substitution causes Apparent mineralocorticoid excess. The hypertension phenotype is also epigenetically modulated by HSD11B2 methylation in subjects heterozygous for the mutation PMID: 26126204 infants with low NR3C1 methylation but high HSD11B2 methylation had lower excitability scores; those with high NR3C1 methylation but low HSD11B2 methylation had more asymmetrical reflexes PMID: 25459891 Insulin reduced the 11beta-HSD2 activity in cancer colon cell lines (HCT116, SW620 and HT-29) at the transcriptional level, in a time and dose dependent manner. PMID: 25133511 Preeclampsia reduces methylation level at fetal HSD11B2 promoter. PMID: 25200528 hypertensivesThe 11bHSD2 polymorphism-derived allele frequency was very low, completely absent in controls and no homozygous mutants were found PMID: 25572238 variants of HSD11B2 may be not a cause of obesity. PMID: 24729284 The inverse association of offspring 11beta-HSD-2 activity with maternal age at Holocaust exposure is consistent with the influence of glucocorticoid programming. PMID: 24971590 No correlation was observed between the placental gene expression of 11bHSD-2 and infantile growth at 10 months of age. PMID: 24147632 Results show a link between the site-specific methylation of placental 11beta-hydroxysteroid dehydrogenase (HSD11B2) promoter and the development of intrauterine growth restriction (IUGR). PMID: 24129435 the downregulation of 11HSD2 gene expression is a typical feature of the development of colorectal polypous lesions and their transformation into colorectal adenocarcinoma PMID: 24189979 fetal HSD11B2[CA]n microsatellite polymorphism of the HSD11B2 gene in healthy uncomplicated human pregnancy is associated with maternal cortisol concentration PMID: 24685985 placental 11bHSD2 expression is significantly reduced in pregnancies complicated by intrahepatic cholestasis of pregnancy. PMID: 24262137 Increased glucocorticoid exposure as a consequence of reduced 11beta-hydroxysteroid dehydrogenase type 2 activity is likely to be a critical determinant of growth in early life PMID: 24517145 analysis of placental 11-B hydroxysteroid dehydrogenase methylation patterns and how they relate to prenatal socioeconomic adversity PMID: 24040322 Data suggest that placental HSD11B2 mRNA expression during prolonged pregnancy is higher in women who do not respond to induction of labor than in responders and in women who enter labor spontaneously. PMID: 24054540 Data suggest that expression of HSD11B2 in placenta/trophoblast cells is regulated, in part, via the ERK1/2 (mitogen-activated protein kinases 3/1) signaling pathway; this pathway mediates cadmium chloride repression of placental HSD11B2 activity. PMID: 23966319 HSD11B2 CA-repeat genotype is not associated with hypertension itself, but with renal sodium excretion, probably through salt intake/appetite. PMID: 23446772 11beta-HSD2 expression can be modulated by PPARalpha and PPARgamma in placental trophoblasts through Sp-1 PMID: 24169559 HSD11B1 and HSD11B2 single nucleotide polymorphisms in hypertensive disorders in pregnancy. PMID: 23659736 Genotyping indicated no hypertension related mutations in the coding region and short introns of HSD11B2 PMID: 23303402 genetic association studies in Japan: Data suggest that in normal subjects total CA-repeat length in HSD11B2 is negatively correlated with insulin secretion; subjects with longer CA repeats in HSD11B2 are more susceptible to glucose intolerance. PMID: 23357976 Data suggest that interaction of p300/Sp1 (lysine acetyltransferase 2B/transcription factor Sp1) with HSD11B2 promoter plays crucial role in histone acetylation in syncytiotrophoblasts; these interactions may be important in placentation. PMID: 23714681 cortisol/cortisone ratio increased with age, but cortisone decreased, suggesting decrease in 11beta-HSD2 activity. Results suggest that cortisol-mediated activation of mineralocorticoid receptor may explain blood pressure increase in elderly subjects. PMID: 23443726

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human 11-Beta-Hydroxysteroid Dehydrogenase Type 2 (HSD11B2) Protein (His)

Recombinant Human 11-Beta-Hydroxysteroid Dehydrogenase Type 2 (HSD11B2) Protein (His)

Product Overview

Target Details

FAQs