Recombinant Hirudin Protein
Beta LifeScience
SKU/CAT #: BLA-11528P
Recombinant Hirudin Protein
Beta LifeScience
SKU/CAT #: BLA-11528P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Host Species | Leech |
| Synonym | Hirudin 1 Lepirudin Refludan |
| Description | Recombinant Hirudin Protein was expressed in Pichia pastoris. It is a Full length protein |
| Source | Pichia pastoris |
| AA Sequence | VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQS HNDGDFEEIPEEYLQ |
| Purity | >95% purity as determined by SDS-PAGE |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Bioactivity | The specific activity was found to be>14,000ATU/mg. |
| Formulation | Lyophilised |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |
