Recombinant Herpes Simplex Virus Type 2 Icp47 Protein (US12) Protein (His-KSI)
Beta LifeScience
SKU/CAT #: BLC-11232P

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Herpes simplex virus type 2 (strain SA8) (Simian agent 8) US12.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Herpes simplex virus type 2 (strain SA8) (Simian agent 8) US12.
Recombinant Herpes Simplex Virus Type 2 Icp47 Protein (US12) Protein (His-KSI)
Beta LifeScience
SKU/CAT #: BLC-11232P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Herpes Simplex Virus Type 2 Icp47 Protein (US12) Protein (His-KSI) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P60504 |
Target Symbol | US12 |
Synonyms | US12; ICP47 protein; Immediate-early protein IE12; Immediate-early-5; Infected cell protein 47; US12 protein; Vmw12 |
Species | Herpes simplex virus type 2 (strain SA8) (Simian agent 8) |
Expression System | E.coli |
Tag | N-6His-KSI |
Target Protein Sequence | MSSLYLATVDAFLRNPHTRHRTCADLRRELDAYADEERREAAKAIAHPDRPLLAPPSAPPNHSHLAARETAPPPAATP |
Expression Range | 1-78aa |
Protein Length | Full Length |
Mol. Weight | 23.9 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Plays a role in the inhibition of host immune response. Binds specifically to transporters associated with antigen processing (TAP), thereby blocking peptide-binding and translocation by TAP as well as subsequent loading of peptides onto MHC class I molecules. Empty MHC I molecules are retained in the endoplasmic reticulum and ultimately directed to proteasomal degradation. In consequence, infected cells are masked for immune recognition by cytotoxic T-lymphocytes. |
Subcellular Location | Host cytoplasm. Host nucleus. |
Protein Families | Herpesviridae US12 family |