Recombinant Hepatitis Delta Virus Genotype I Small Delta Antigen (S-HDAG) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07765P
Greater than 85% as determined by SDS-PAGE.
Recombinant Hepatitis Delta Virus Genotype I Small Delta Antigen (S-HDAG) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07765P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Hepatitis Delta Virus Genotype I Small Delta Antigen (S-HDAG) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P06934 |
| Target Symbol | P06934 |
| Synonyms | p24 |
| Species | Hepatitis delta virus genotype I (isolate Italian) (HDV) |
| Expression System | E.coli |
| Tag | N-6His&C-Myc |
| Target Protein Sequence | MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFP |
| Expression Range | 1-195aa |
| Protein Length | Full Length |
| Mol. Weight | 29.3 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Promotes both transcription and replication of genomic RNA. Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. May interact with host RNA polymerase II thereby changing its template requirement from DNA to RNA. RNA pol II complex would then acts as an RNA-directed RNA polymerase, and transcribe and replicate HDV genome. |
| Subcellular Location | Virion. Host nucleus. |
| Protein Families | Hepatitis delta antigen family |
