Recombinant Helicobacter Pylori Vacuolating Cytotoxin Autotransporter (VACA) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-02331P
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) vacA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) vacA.
Recombinant Helicobacter Pylori Vacuolating Cytotoxin Autotransporter (VACA) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-02331P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Helicobacter Pylori Vacuolating Cytotoxin Autotransporter (VACA) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P55981 |
| Target Symbol | VACA |
| Synonyms | vacA; HP_0887; Vacuolating cytotoxin autotransporter [Cleaved into: Vacuolating cytotoxin; Vacuolating cytotoxin translocator] |
| Species | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | TTVIIPAIVGGIATGAAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAATHYWVKGGQWNKLEVDMKDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLN |
| Expression Range | 37-245aa |
| Protein Length | Partial |
| Mol. Weight | 26.6kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Induces vacuolation of eukaryotic cells. Causes ulceration and gastric lesions. |
| Subcellular Location | [Vacuolating cytotoxin autotransporter]: Periplasm.; [Vacuolating cytotoxin]: Secreted. Cell surface.; [Vacuolating cytotoxin translocator]: Cell outer membrane; Multi-pass membrane protein. |
| Database References | KEGG: hpy:HP0887 STRING: 85962.HP0887 |
Gene Functions References
- Helicobacter pylori VacA induces autophagic cell death in gastric epithelial cells via the endoplasmic reticulum stress pathway. PMID: 29238039
- The results indicate that cortactin is involved in the regulation of apoptosis induced by VacA in gastric cells. PMID: 26289258
- Genotype testing of vacA s- and m- region will be useful in screening susceptible individuals for duodenal ulcer development. PMID: 25063579
- These results suggested that cagA and vacA gene expression is upregulated in Helicobacter pylori, especially by host cell contact, and Fur has a role in the upregulation. PMID: 24020886
