Recombinant Helicobacter Pylori Dna Protection During Starvation Protein (DPS) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-02678P
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) dps.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) dps.
Recombinant Helicobacter Pylori Dna Protection During Starvation Protein (DPS) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-02678P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Helicobacter Pylori Dna Protection During Starvation Protein (DPS) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P43313 |
| Target Symbol | DPS |
| Synonyms | dps; napA; HP_0243DNA protection during starvation protein; EC 1.16.-.-; Bacterioferritin; HP-NAP; Neutrophil-activating protein A; NAP A |
| Species | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA |
| Expression Range | 1-144aa |
| Protein Length | Full Length |
| Mol. Weight | 32.9kDa |
| Research Area | Microbiology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Protects DNA from oxidative damage by sequestering intracellular Fe(2+) ion and storing it in the form of Fe(3+) oxyhydroxide mineral. One hydrogen peroxide oxidizes two Fe(2+) ions, which prevents hydroxyl radical production by the Fenton reaction. Required for the survival in the presence of oxidative stress. Dps is also a virulence factor that activates neutrophils, mast cells and monocytes. It binds to neutrophil-glycosphingolipids and to sulfated carbohydrates on mucin. It might have a role in the accumulation of neutrophils and monocytes at the site of infection. Induces superoxide anion generation, adhesion and chemotaxis of neutrophils, through a pertussis toxin-sensitive pathway involving MAP kinases. |
| Subcellular Location | Cytoplasm. |
| Protein Families | Dps family |
| Database References | KEGG: heo:C694_01230 STRING: 85962.HP0243 |
Gene Functions References
- H. pylori NapA has unique and separate roles in gastric pathogenesis. PMID: 17030577
