Recombinant Feline Coronavirus Spike Glycoprotein (S) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07545P

Greater than 85% as determined by SDS-PAGE.
Recombinant Feline Coronavirus Spike Glycoprotein (S) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07545P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Feline Coronavirus Spike Glycoprotein (S) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P10033 |
Target Symbol | S |
Synonyms | (S glycoprotein)(E2)(Peplomer protein) |
Species | Feline coronavirus (strain FIPV WSU-79/1146) (FCoV) |
Expression System | E.coli |
Tag | C-6His |
Target Protein Sequence | PMQDNNTDVYCIRSNQFSVYVHSTCKSSLWDNIFNQDCTDVLEATAVIKTGTCPFSFDKLNNYLTFNKFCLSLSPVGANCKFDVAARTRTNEQVVRSLYVIYEEGDNIVGVPSDNSGLHDLSVLHLDSCTDYNIYGRTGVGIIRRTNSTLLSG |
Expression Range | 561-713aa |
Protein Length | Partial |
Mol. Weight | 18.0 kDa |
Research Area | Microbiology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | S1 region attaches the virion to the cell membrane by interacting with host ANPEP/aminopeptidase N, initiating the infection. Binding to the receptor probably induces conformational changes in the S glycoprotein unmasking the fusion peptide of S2 region and activating membranes fusion. S2 region belongs to the class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) regions assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes. |
Subcellular Location | Virion membrane; Single-pass type I membrane protein. Host endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein. |
Protein Families | Alphacoronaviruses spike protein family |
Database References | KEGG: vg:920849 |
Gene Functions References
- Mutations of 3c and spike protein genes correlate with the occurrence of feline infectious peritonitis. PMID: 25150756
- Methionine to leucine substitution at position 1058 in the feline coronavirus (FCoV) spike protein is indicative of systemic spread of FCoV from the intestine, rather than a virus with the potential to cause feline infectious peritonitis. PMID: 24767677
- We identified 2 alternative amino acid differences in the putative fusion peptide of the spike protein that together distinguish FIPV from FECV in >95% of cases. Thus virus apparently acquires its macrophage tropism and spreads systemically. PMID: 22709821
- 5'-terminal region of the S gene is not essential for the virulence of Feline infectious peritonitis virus. PMID: 22718568