Recombinant Feline Coronavirus Non-Structural Protein 7A (7A) Protein (His-SUMO&Myc)
Beta LifeScience
SKU/CAT #: BLC-07172P
Greater than 85% as determined by SDS-PAGE.
Recombinant Feline Coronavirus Non-Structural Protein 7A (7A) Protein (His-SUMO&Myc)
Beta LifeScience
SKU/CAT #: BLC-07172P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Feline Coronavirus Non-Structural Protein 7A (7A) Protein (His-SUMO&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P19742 |
| Target Symbol | 7A |
| Species | Feline coronavirus (strain FIPV WSU-79/1146) (FCoV) |
| Expression System | E.coli |
| Tag | N-10His-SUMO&C-Myc |
| Target Protein Sequence | VPDSSLRVNCLQLLKPDCLDFNILHKVLAETR |
| Expression Range | 44-75aa |
| Protein Length | Partial |
| Mol. Weight | 19.7 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | May function in the formation of membrane-bound replication complexes or in the assembly of the virus. |
| Subcellular Location | Host membrane; Single-pass membrane protein. |
| Protein Families | Coronaviruses ns7/ns7a protein family |
| Database References | KEGG: vg:10040187 |
Gene Functions References
- These results indicate that the 7a protein is a type I interferon antagonist and protects the virus from the antiviral state induced by interferon, but it needs the presence of ORF3-encoded proteins to exert its antagonistic function. PMID: 24189622
