Recombinant Esx-1 Secretion-Associated Protein Espk (ESPK) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01543P

Greater than 90% as determined by SDS-PAGE.
Recombinant Esx-1 Secretion-Associated Protein Espk (ESPK) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01543P
Collections: High-quality recombinant proteins, Other recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Esx-1 Secretion-Associated Protein Espk (ESPK) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P9WJC1 |
Target Symbol | ESPK |
Species | Mycobacterium tuberculosis |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | VEADEDTFYDRAQEYSQVLQRVTDVLDTCRQQKGHVFEGGLWSGGAANAANGALGANINQLMTLQDYLATVITWHRHIAGLIEQAKSDIGNNVD |
Expression Range | 21-114aa |
Protein Length | Partial |
Mol. Weight | 17.7 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | May act as a chaperone that facilitates EspB secretion through an interaction with EccCb1. |
Subcellular Location | Cytoplasm. |
Database References | KEGG: mtu:Rv3879c STRING: 83332.Rv3879c |
Gene Functions References
- The T cell response rates to Rv3879c were 45% (95% CI: 31%-57%)in the TB group and were 2.6% in the control group. Rv3879c peptides can be candidates for inclusion in new T cell-based tests for MTB infection. PMID: 18686610