Recombinant Escherichia Phage T7 Dna Primase/Helicase (4) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-11278P
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T7 (Bacteriophage T7) 4.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T7 (Bacteriophage T7) 4.
Recombinant Escherichia Phage T7 Dna Primase/Helicase (4) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-11278P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Escherichia Phage T7 Dna Primase/Helicase (4) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P03692 |
| Target Symbol | 4 |
| Synonyms | 4; DNA primase/helicase; EC 2.7.7.-; EC 3.6.4.12; Gene product 4; Gp4 |
| Species | Escherichia phage T7 (Bacteriophage T7) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | KKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYS |
| Expression Range | 151-548aa |
| Protein Length | Partial |
| Mol. Weight | 51.3 kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | ATP-dependent DNA helicase and primase essential for viral DNA replication and recombination. The helicase moves 5' -> 3' on the lagging strand template, unwinding the DNA duplex ahead of the leading strand polymerase at the replication fork and generating ssDNA for both leading and lagging strand synthesis. ATP or dTTP hydrolysis propels each helicase domain to translocate 2 nt per step sequentially along DNA. Mediates strand transfer when a joint molecule is available and participates in recombinational DNA repair through its role in strand exchange. Primase activity synthesizes short RNA primers at the sequence 5'-GTC-3' on the lagging strand that the polymerase elongates using dNTPs and providing the primase is still present. |
| Database References | KEGG: vg:1261046 |
Gene Functions References
- structural model of a bacteriophage T7 DNA helicase-DNA polymerase complex PMID: 22977246
- Zinc-binding domain of the bacteriophage T7 DNA primase modulates binding to the DNA template PMID: 23024359
- Data show that tryptophans Trp-42, -97, and -147 play different but essential roles in T7 DNA primase. PMID: 22605336
- The ligation state of the zinc ion was examined by X-ray absorption spectroscopy and biochemical analysis of genetically altered primases, was analysed. PMID: 19206208
- thioredoxin-binding domain of T7 DNA polymerase is the site of interaction of the phage-encoded helicase/primase (gp4) and ssDNA binding protein (gp2.5) PMID: 15795374
- residues Glu-157, Glu-159, Asp-161, Asp-207, Asp-209, and Asp-237 are essential for binding affinity for ATP PMID: 15917241
- The switch in contacts between Asp(263) and Tyr(411), Lys(408), or Arg(404) in helix E of the adjacent subunit results in conformational changes that modulate helicase and primase activity. PMID: 19574219
