Recombinant Escherichia Phage Lambda Capsid Decoration Protein (D) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-01884P

Greater than 90% as determined by SDS-PAGE.
Recombinant Escherichia Phage Lambda Capsid Decoration Protein (D) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-01884P
Collections: High-quality recombinant proteins, Other recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Escherichia Phage Lambda Capsid Decoration Protein (D) Protein (GST) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P03712 |
Target Symbol | D |
Synonyms | Auxiliary protein D Gene product D Major capsid protein D |
Species | Escherichia phage lambda (Bacteriophage lambda) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | MTSKETFTHYQPQGNSDPAHTATAPGGLSAKAPAMTPLMLDTSSRKLVAWDGTTDG |
Expression Range | 1-56aa |
Protein Length | Partial |
Mol. Weight | 32.5 kDa |
Research Area | Cardiovascular |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Stabilizes the expansion of the capsid head shell after genome packaging. The packaging of viral genome in the procapsid triggers a dramatic reconfiguration of the capsid shell, expanding from roughly 50nm to 60nm while the capsid thickness decreases. 415 capsid decoration protein molecules cooperatively bind the expanded capsid, thereby stabilizing the mature capsid shell. |
Subcellular Location | Virion. Host cytoplasm. |
Protein Families | Lambda phage gpD family |
Database References | KEGG: vg:2703529 |