Recombinant Epstein-Barr Virus Trans-Activator Protein Bzlf1 (BZLF1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-03779P
Greater than 85% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) BZLF1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) BZLF1.
Recombinant Epstein-Barr Virus Trans-Activator Protein Bzlf1 (BZLF1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-03779P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Epstein-Barr Virus Trans-Activator Protein Bzlf1 (BZLF1) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q3KSS8 |
| Target Symbol | BZLF1 |
| Synonyms | BZLF1; Trans-activator protein BZLF1; EB1; Zebra |
| Species | Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | MMDPNSTSEDVKFTPDPYQVPFVQAFDQATRVYQDLGGPSQAPLPCVLWPVLPEPLPQGQLTAYHVSAAPTGSWFPAPQPAPENAYQAYAAPQLFPVSDITQNQLTNQAGGEAPQPGDNSTVQPAAAVVLACPGANQEQQLADIGAPQPAPAAAPARRTRKPLQPESLEECDSELEIKRYKNRVASRKCRAKFKHLLQHYREVASAKSSENDRLRLLLKQMCPSLDVDSIIPRTPDVLHEDLLNF |
| Expression Range | 1-245aa |
| Protein Length | Full Length |
| Mol. Weight | 33.8 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Plays a key role in the switch from latent infection to lytic cycle producing new virions. Acts as a transcription factor, inducing early lytic cycle genes, and as a origin binding protein for genome replication. BZLF1 activates the promoter of another EBV gene (BSLF2+BMLF1). |
| Subcellular Location | Host nucleus. |
| Protein Families | BZIP family |
