Recombinant Epstein-Barr Virus Small Capsomere-Interacting Protein (SCP) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-03629P
Greater than 90% as determined by SDS-PAGE.
Recombinant Epstein-Barr Virus Small Capsomere-Interacting Protein (SCP) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-03629P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Epstein-Barr Virus Small Capsomere-Interacting Protein (SCP) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P14348 |
| Target Symbol | SCP |
| Synonyms | SCP; BFRF3; Small capsomere-interacting protein |
| Species | Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | NQNNLPNDVFREAQRSYLVFLTSQFCYEEYVQRTFGVPRRQRAIDKRQRASVAGAGAHAHLGGSSATPVQQAQAAASAGTGALASSAPSTAVAQSATPSVSSSISSLRAATSGATAAASAAAAVDTGSGGGGQPHDTAPRGARKKQ |
| Expression Range | 31-176aa |
| Protein Length | Partial |
| Mol. Weight | 30.7kDa |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly. |
| Subcellular Location | Virion. Host nucleus. |
| Protein Families | Herpesviridae small capsomere-interacting protein family |
| Database References | KEGG: vg:3783701 |
Gene Functions References
- Secondary structure analysis suggested that BFRF3 primarily consisted of alpha-helices (59.1%) and random coils (36.9%), whereas a beta-strand accounted for the least prevalent component (4.0%). PMID: 24242362
